KEGG   Nipponia nippon (crested ibis): 104020099
Entry
104020099         CDS       T05756                                 

Gene name
MAPK1
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04350  TGF-beta signaling pathway
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04520  Adherens junction
nni04540  Gap junction
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
nni05132  Salmonella infection
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020099 (MAPK1)
   04012 ErbB signaling pathway
    104020099 (MAPK1)
   04350 TGF-beta signaling pathway
    104020099 (MAPK1)
   04370 VEGF signaling pathway
    104020099 (MAPK1)
   04371 Apelin signaling pathway
    104020099 (MAPK1)
   04068 FoxO signaling pathway
    104020099 (MAPK1)
   04150 mTOR signaling pathway
    104020099 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104020099 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104020099 (MAPK1)
   04210 Apoptosis
    104020099 (MAPK1)
   04218 Cellular senescence
    104020099 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104020099 (MAPK1)
   04520 Adherens junction
    104020099 (MAPK1)
   04540 Gap junction
    104020099 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104020099 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104020099 (MAPK1)
   04621 NOD-like receptor signaling pathway
    104020099 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    104020099 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104020099 (MAPK1)
   04912 GnRH signaling pathway
    104020099 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    104020099 (MAPK1)
   04916 Melanogenesis
    104020099 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104020099 (MAPK1)
   04270 Vascular smooth muscle contraction
    104020099 (MAPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104020099 (MAPK1)
  09172 Infectious disease: viral
   05164 Influenza A
    104020099 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104020099 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104020099 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nni04147]
    104020099 (MAPK1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104020099 (MAPK1)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104020099 (MAPK1)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     104020099 (MAPK1)
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104020099 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 104020099
NCBI-ProteinID: XP_009471746
LinkDB
Position
Unknown
AA seq 327 aa
MNLVFLITNVIFLSSSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIG
INDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANV
LHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGY
TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIIXSLPHKNKV
PWNRLFPNADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDM
ELDDLPKEKLKELIFEETARFQPGYRS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaatttagtattcctaataactaatgttattttcctttctagttctgcctatgataat
gtcaacaaagttcgagttgctataaagaaaatcagtccttttgagcatcagacgtactgc
cagagaactctgagagagattaagatcctactgcgcttcaggcatgagaatattattgga
ataaatgatattatcagagctccgactattgaacaaatgaaagatgtatacattgtgcaa
gatcttatggagacagatctttacaagctcttaaagactcaacacctcagcaacgaccac
atttgttatttcctttaccagattctgagagggttaaaatatatccattcagccaatgtg
cttcatcgtgacctcaaaccttcgaatttgctgcttaacaccacttgtgatctcaagatt
tgtgactttggactggctcgtgttgcagatccagatcatgatcacacaggatttttgaca
gaatatgtggccacgcgttggtacagggctcctgaaatcatgctgaattctaagggttac
accaagtctattgacatctggtcagtaggctgtattctggcagagatgctctccaacaga
cctatctttccaggaaaacactaccttgaccaacttaaccatatccttggcatacttgga
tccccttcccaagaagatttgaattgtataattnnttccctaccacacaaaaacaaggta
ccatggaacaggctgtttccaaatgctgaccccaaagcacttgatttgttggataaaatg
ttgacctttaatcctcataagcggattgaagtcgagcaagctttagcccatccctatctg
gagcagtattatgatccgagcgacgagcctgtagctgaagcacccttcaagtttgatatg
gagttggatgacctgccgaaggaaaagctgaaagaactgatttttgaggaaactgctaga
ttccagccgggatatcgatcttaa

DBGET integrated database retrieval system