KEGG   Nipponia nippon (crested ibis): 104020165Help
Entry
104020165         CDS       T05756                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nni00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104020165 (SOD1)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104020165 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104020165
NCBI-ProteinID: XP_009471822
LinkDB All DBs
Position
Unknown
AA seq 137 aa AA seqDB search
MINSFPLKGNGPVTVTGHISGLADGDHGFHVHEFGDNTNGCTSAGSHFNPEGKQHGGPKD
AERHVGDLGNVTAKGGVAEVEIEDSVISLSGPHSIIGRTMVVHEKRDDLGRGGDNESKLT
GNAGPRLACGVIGIAKI
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgataaattcttttccattaaagggtaatggaccagtgacagttactggacacatcagt
ggcttggctgatggagatcatgggttccatgtccatgagtttggggacaatacaaatgga
tgtaccagtgcaggttctcacttcaatcctgaaggcaagcagcacggtggaccaaaggat
gcagaaaggcatgtgggagaccttggcaatgtgactgctaaaggaggcgtggcagaagtg
gaaatagaagattccgtcatttcgcttagtggaccacacagcatcatcggacgtaccatg
gtggtccatgaaaaacgtgatgacctgggtagagggggagataatgagagcaaattaact
ggaaatgctggccctcgtttagcttgtggtgtaattggaatagcgaaaatctaa

DBGET integrated database retrieval system