KEGG   Nipponia nippon (crested ibis): 104020209
Entry
104020209         CDS       T05756                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04260  Cardiac muscle contraction
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020209 (CACNA1C)
   04020 Calcium signaling pathway
    104020209 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104020209 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104020209 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    104020209 (CACNA1C)
   04270 Vascular smooth muscle contraction
    104020209 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104020209 (CACNA1C)
Ion channels [BR:nni04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104020209 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel TMEM126
Other DBs
NCBI-GeneID: 104020209
NCBI-ProteinID: XP_009471870
LinkDB
Position
Unknown
AA seq 2187 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKSFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNV
PGADIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNSHNFFYVFLAIAVDNLADAESLTSAQKEEEEEKERKKL
ARTASPEKKQEIEKTAVEEETKEEKIELKSITADGESPPATKINVDDYQPNENEEKSPYP
TTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVN
DNIFTNLILFFILLSSISLAAEDPVRHLSFRNQILFYFDIVFTVIFTIEIALKILGNADY
VFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILR
VLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSC
TDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWP
ELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYK
NCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLIFFTICL
AMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSII
DVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFF
RLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALN
DTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCG
SSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEA
KGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRT
ALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYF
RKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVS
AASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKL
VDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTIRVQEAP
WKLPSKSSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQ
LTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHH
QALAVAGLSPLLQRSHSPTMFSRLCATPPATPCSRGWPQQTIPTLRLDGAESSEKLNSSF
PSVHCGSRYTENTGCSSPRRARPVSLTVPSQTGGSSRQFHGSAGSLVEAVLISEGLMQFA
QDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGE
EEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 6564 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgtccagctcatgccaacatgaatgccaatgcagctgcagggcttgcccca
gagcatattcctactccaggggcagctctgtcctggcaagctgcgattgatgctgccagg
caagccaaactgatgggtagtgctggcaatgcaacaatatccacagctagctccacgcag
agaaaacggcagcagtatgggaaacagaaaaaacagggtaccaccacagctacacgtcct
ccccgggcactgctgtgtttaacactgaaaaatcccatccggagggcatgcatcagcatc
gtcgaatggaaatcatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tatggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggatttgatgttaaagcactgcgggctttccga
gtattacgtccgttacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcattatt
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctatcat
gtgcaagggggacttatagatacgcctgcagaagatgatccatctccctgtgccccccag
tctgcacatgggcggcagtgtcagaatggcacggagtgcaaggcaggctgggagggtcct
aagcacggcattacgaactttgacaattttgcttttgccatgctgacggtgtttcagtgc
atcacgatggagggctggacagatgtactgtactgggtcaatgatgccataggaagggac
tggccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttg
gttctcggtgtacttagcggggagttttccaaagaaagagagaaggctaaggctcggggc
gatttccagaagttacgggaaaaacaacagctagaggaggatttgaaaggatacttagac
tggataactcaagcagaagacattgacccagaaaatgaagatgaaggcatggatgaggaa
aagcctcgaaacatgagcatgcccaccagtgagaccgagtccgtgaacacagacaacgtc
cctggagcagatattgaaggagaaaactgcggtgctaggctagcgcatcggatctcaaaa
tcaaagtttagtcgctactggcgccgatggaatcgattctgcagaagaaagtgccgtgcc
gctgtcaagtccaatgttttctactggttggtgatcttccttgtgtttctcaacaccctt
accattgcctctgaacactacaaccagccagactggctcacggaggtccaagacactgcc
aataaggtgctgctagctcttttcacggcagagatgctgctgaagatgtacagccttggt
ctccaggcctattttgtgtccctcttcaaccgctttgactgtttcattgtgtgtggagga
atcctggaaacgatcctggttgagacaaagatcatgtcaccactgggcatttctgtgttg
agatgtgttcgactcctaagaatatttaaaatcacaagatactggaactccctgagtaac
cttgtggcttcactcctgaattcagttcgctccattgcctccctgttgctgcttctcttc
ctcttcattatcatattctcactcctggggatgcagctctttgggggcaagtttaacttt
gatgagatgcagaccaggaggagtacattcgacaacttcccccagtccctcctcactgtg
tttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgt
ggaaactcacacaattttttttatgtatttttggccattgccgtggacaaccttgctgat
gctgagagtttaacgtctgcacagaaagaggaggaagaggaaaaagaaaggaaaaagcta
gctaggactgctagtcctgaaaagaaacaggagatagaaaaaacagctgtggaggaggag
acaaaggaggagaaaattgagctgaaatcgatcactgctgatggagaatccccgcctgct
accaagatcaacgtggatgattatcagcccaatgaaaacgaagaaaagagcccatatcct
acaacagaagcaccagcagaggaagatgaggaagaacctgagatgcctgtcggccctcgg
cctcgccccatgtctgagctgcacctcaaggaaaaggctgtgcccatgcctgatgccagt
gcttttttcatcttcagtcctaacaacaggtttcgtgtgcactgccatcgaatcgttaac
gataacattttcaccaacctgatcctatttttcatcttgctcagcagcatctccctggca
gctgaggaccccgtccgacacctctcctttaggaaccaaattctcttttattttgatata
gtttttactgtcattttcaccattgaaattgctctgaagatcctaggcaatgcagactat
gtcttcactagtatctttacattagaaattattcttaagatgaccgcatacggggctttc
ctccataagggctccttctgcagaaactatttcaacatcttagacctcctggtggtcagc
gtttctctcatctcttttgggatccaatccagtgctatcaatgtggtgaagattctgcgt
gttctgcgagtgcttagaccactgagggccatcaacagagccaaaggactaaagcatgtg
gtccagtgtgtgtttgtcgccatccgaaccatcggaaacattgtgattgttaccactttg
ctgcagttcatgtttgcctgcattggagttcagttgtttaagggcaagctgtacagctgc
actgatagctccaagcagacggcagcagaatgcagagggtactacattacatacaaggat
ggtgaggtcaaccagccaatgatacagccccggagctgggagaacagcaagtttgacttt
gacaacgtcttgactgccatgatggccctcttcactgtctcaacctttgagggctggcca
gagttgctgtataggtccattgattcccacatggaggatgtgggacccatctataatcac
agggttgagatctccatcttctttattatctacatcatcatcattgctttcttcatgatg
aacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaacaggagtacaag
aactgtgagctggacaaaaaccagcgccagtgtgtagaatatgccctgaaggcccggccc
ctgcggagatacatccctaaaaaccagtaccagtataaagtttggtatgtggtcaactcc
acctattttgaatacctgatgttcgttctgatcctgctgattttttttaccatctgcctg
gccatgcaacactacggtcagagctgcatgttcaaggaagccatgaatatcctcaacatg
ctcttcactggcctcttcactgttgagatggtcctgaaattaatcgccttcaaacccaag
ggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagcattata
gacgtcattctcagtgaaactaatcactatttctgtgatgcatggaatacatttgacgcc
ttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacat
acccaatgctcttcctctatgaatgcagaggaaaactctcgcatctcaatcaccttcttc
cgactcttccgcgtgatgcgtctcgtgaagcttctgagccgaggggagggcatccggacg
ctgctttggaccttcatcaagtccttccaggctctcccctatgtggctcttttaatagtg
atgttgttcttcatctacgctgtgattgggatgcaggtgtttggtaaaattgcgctgaac
gataccacagaaatcaaccgcaacaacaacttccagaccttcccccaggcagtgctgctg
cttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcatgtctcccagac
aagaagtgtgacccggagtcggagccggccaactccactgaagccgatcactcctgtggc
agcagctttgccgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatc
aatctttttgtagctgttataatggataactttgattacctgacacgggactggtccatt
ttaggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagcc
aagggacggatcaaacacttggacgtggtgacgctgctccggcggattcagcccccgctg
ggcttcgggaagctctgccctcaccgggtggcttgcaaacgccttgtctccatgaatatg
ccactgaacagtgatgggactgtcatgttcaatgccactctctttgcattggtcagaaca
gcactgaggatcaagacggaaggtaacctggagcaagccaacgaagagctgagagcaata
attaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgccccccgca
ggtgatgatgaggtgaccgttgggaagttctacgccactttcctgattcaggagtatttc
cggaagttcaagaaacgtaaagaacagggactggtgggcaagccctcccagcgcaacgcg
ctctccttacaggctggtctgcgcacacttcacgacattgggccagagatccgacgagca
atttctggagacctgacagctgaagaagagctagataaggccatgaaagaagctgtttct
gctgcctctgaagatgatatcttccggagagccggaggcttgttcggaaaccatgtcagc
tattaccaaagcgatggcaggagcgcgttcccacagacattcaccacccagcgacctttg
cacatcaataagtctggcaacaaccagggagataccgagtctccatctcatgagaagctg
gtggactccaccttcactcccagcagctactcatcttcaggctccaatgccaacatcaac
aatgccaacaacactgccctgtgccgcttccccagcccacccagctaccccagcactgtc
agcacagtggaaggccacgggacccccttgtcacccaccatacgtgtgcaggaggctcct
tggaaactaccttccaaaagctccagttccagagacagccagctggcaattgtttgccaa
gaggaagtgtctcaggatgagacttatgatgaaaatttgaatgaagacattgagtactgt
agtgaaccaagtctgctctctactgaaatgcttgcataccaagatgatgaaaacagacaa
cttactccaccagaaaacaacaaaggagaggacacccggcactctccgaagaaagggttt
ctgtgctcctcagcactaggtcgaagagcatcttttcacttagagtgtctgaaaagacag
aaaaaccagggcgtagacgtctcgcagaagacagttctgcctttgcatctggtacatcat
caggcgttagcagtggccggcctgagtcccctgctccagcgaagccattcccccaccatg
ttctctcggctctgtgctacgccccccgctacaccctgcagccgtggctggccgcaacag
accatcccgactctgcgcctcgacggggcggagtccagtgagaagctcaacagcagcttc
ccgtcagtccactgcggctctcggtacactgagaacaccggctgcagcagcccgaggaga
gccaggccggtctccctcaccgtccccagccagaccggagggagcagcaggcagtttcac
ggcagcgctggcagcctggtcgaagcggtcttgatttcggaaggactgatgcagtttgct
caagatccaaagttcattgaggtcacaacccaggagctcgcagatgcctgtgacatgacg
atagaagagatggaaaatgcagcagacaacattctcaacggtaacagcaagcagagcccc
aatggcaacctcttgccttttgttaactgcagggacccagggcaggacagtgcaggagag
gaagaggaagaggtgcagaacccggattgtagaaaaagtcaggaggagctcaaggacagc
aggatttatatcagcagcctgtag

DBGET integrated database retrieval system