KEGG   Nipponia nippon (crested ibis): 104020241
Entry
104020241         CDS       T05756                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04060  Cytokine-cytokine receptor interaction
nni04068  FoxO signaling pathway
nni04144  Endocytosis
nni04218  Cellular senescence
nni04350  TGF-beta signaling pathway
nni04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020241
   04350 TGF-beta signaling pathway
    104020241
   04068 FoxO signaling pathway
    104020241
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104020241
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104020241
  09143 Cell growth and death
   04218 Cellular senescence
    104020241
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104020241
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104020241
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104020241
Protein kinases [BR:nni01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   104020241
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 104020241
NCBI-ProteinID: XP_009471906
LinkDB
Position
Unknown
AA seq 589 aa
MSFTLHQVQNFSSSGNSDPFPGTLLGSAVTTSPSQVCTTITACSAGARRSLKTNLCKWCD
STLPACEEKVCYSNCNLNSYCEDPYEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNY
NTSRCIMTHQPSEDGIIYICGCVDEQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPP
LLVAVMITVIFYLCRTQKRRKRAKAWGGKAGQPPALPEPGRSAEREEKLSVLMDESPAGA
SPTCASSRPAELLPIELDEMVGKGQFAEVWRAKLSHSRSGQYETVAVKIFPCEEYSSWKN
ESQIFTDASLKHDSVLRFLTAEDRGAGPRREYWLITAYHSRGNLKDYLSRHILSWMDLQK
MAGSLVSGVAHLHSDYTACGRPKIPIAHRDIKSTNVLVKNEQECVLCDFGIAIRLDPSLT
ADDFANSGQVGTARYMAPEVLESRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKN
YELPFGSKVQEQPCVDTMRDIVLHGRGRPEIPSSWLVHQGMRFLCDTITECWDHDPEARL
TAHCVAERFNLMAQMDCDDILNNNTDNEASKTASPGGECQDSDGSRNMQ
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgtcgtttactctccaccaggtccaaaacttcagctcttctgggaactcggaccccttc
ccgggaacgcttcttgggagtgccgtgactacaagtccttctcaggtctgtacaactatt
acagcctgcagtgccggcgcccgccgcagcctgaagaccaacctgtgcaagtggtgcgac
tccacgctgccggcctgcgaggagaaggtgtgctacagcaactgcaacctcaactcctac
tgcgaggacccctacgagatctgcgtggccatatggagacaggacaacgagagcatcagg
atcagcacgctctgccacaacccccaccgccccattgaaaacctcatggtccccaactac
aacacctcacgctgcatcatgacccaccagcccagtgaggacgggatcatctacatctgc
ggctgcgtggatgagcaggagtgcaatgataaacttatctttgaaaatcacaccaatggc
tactccatgctgcagagcaaagaggtcatcccggtggccgccatcagcctcctgcccccg
ctgctggtagcagtgatgatcacagtgatattttacctctgccgcacacagaagcggcgc
aagagggccaaggcgtggggcgggaaggcggggcagcccccggcgctgccagagccaggg
aggtccgctgagcgggaggagaagttgtccgtgctgatggacgagagcccggccggtgcc
agccccacctgcgccagcagccgccctgccgagctgctccccatcgagctggacgagatg
gtgggcaaagggcagtttgcggaggtgtggagggccaagctgagccacagccgctcgggg
cagtacgagacggtggccgtgaagatcttcccctgcgaggagtactcctcctggaagaac
gagagccagatcttcaccgacgccagcctcaagcacgacagcgtcctgcggttcctcacc
gccgaggaccggggtgcagggccccgccgggaatactggctcatcaccgcctaccacagc
cgtggcaacctcaaggactacctctcccgccacatcctgagctggatggacctgcagaag
atggcaggctccctggtgagcggggtggcccacctccacagcgactacaccgcctgcggc
aggccgaaaatccccatcgcccaccgggacatcaaaagcaccaacgtcctagtgaagaac
gagcaggagtgcgtgctctgcgacttcggcatcgccatacgcctcgacccttccctgacg
gcggatgactttgccaacagcgggcaggtgggcactgcgaggtacatggccccagaggtc
ctggagtccagggtgaacctggaagacctggagtctttcaagcagatggacgtctactcc
atggccctcgttttgtgggaaatggcttccagatgtgaagtggtaggagaggtaaagaat
tatgagctgccttttgggtcaaaagtccaggagcagccctgcgtggataccatgagggac
atcgtgctgcatggcagaggacgccccgagatcccgagcagctggctggtacatcaggga
atgcgttttctgtgcgacaccatcacggagtgctgggaccacgaccccgaggctcgcctc
accgcccactgcgtggccgagcgcttcaacctgatggcacagatggattgcgacgacatc
ctcaacaacaacacggacaacgaggccagcaaaacagcttctccaggcggggagtgccag
gacagtgatgggagcagaaatatgcagtga

DBGET integrated database retrieval system