KEGG   Nipponia nippon (crested ibis): 104020525
Entry
104020525         CDS       T05756                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04310  Wnt signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
Module
nni_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104020525 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104020525 (PLCB2)
   04371 Apelin signaling pathway
    104020525 (PLCB2)
   04020 Calcium signaling pathway
    104020525 (PLCB2)
   04070 Phosphatidylinositol signaling system
    104020525 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104020525 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104020525 (PLCB2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104020525 (PLCB2)
   04916 Melanogenesis
    104020525 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104020525 (PLCB2)
   04270 Vascular smooth muscle contraction
    104020525 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104020525 (PLCB2)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104020525 (PLCB2)
Membrane trafficking [BR:nni04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104020525 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104020525 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 104020525
NCBI-ProteinID: XP_009472232
LinkDB
Position
Unknown
AA seq 1209 aa
MSMLTPVLQPLEVKEYLSKGERFIKWDDETASASPVILRVDPKGFYLYWTYQNKEMEILD
ITSIRDTRVGRFAKIPKCQKLREVFNLDYPHSFLLKTLTIVSGPDMVDLTFHNFVSYKEN
VGKSWAEDIMAIVRNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKRV
EAALSACHLPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHLKAKPYMTKEHL
AKFINKKQRDSRLNDILFPPAKPEQVQSLIEKYEPSGINIQRGQLSPEGMVWFLCGPENN
VIALDKLVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDCW
KGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKMA
EYCRTIFGDMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQSVSGKRQNSLKKGRN
VEPGIIEQPTPTDAEDTVWAGDVVEEEPEEEEEHLGNLDEEEIKKMQSDEGTAGLEVTAY
EEMSSLVNYIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPVQFVEYNKRQMSRI
YPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMRR
PDKQFDPFSVDRIDVVVASTLSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKLT
STANSINPVWKEEAFVFEKIMMPELASLKIAAWEEGGKFIGHRVIPVIAMHSGYHHVCLR
SESNMPLTMPSLFVYLEIKDYVPDAWADLTIALSNPIKFFSLQDKRSVKLKDGSVERLGT
QRNFPSAETNGIPDSTGNFSTPLSNGPAGAAAFPKDENVIEVTQIAEPQTASLTELQQMK
LFLKLLKKQEKELRELERKGSKRREELLQKYSVLFSESVCYGGKKRMMHARKTQKKRSLT
TGDVGTCANPVEMAESLDSRVLELRERLEMDLIQLGEEHHDGIRRKKEQHATEQVTKIIE
LAREKQTAELKALKESSESNIKNIKKKLEAKRVDRIQAMMRNTSDKAAQERLKKEINNSH
IQEVVQTIKRVTEKTARYQQKLEEKQADNLRTIKEKESQLQQEALAEYEEKLKSLNIEVQ
EMVKNFAKAGFPGEPEIQKEVVQSIPEGEGGSTEQLEEKIPVAEVSRLTIAMAEPPGAET
DVETEESIF
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgtccatgcttacccctgtcctgcagcccctggaggtgaaggagtatctgtccaagggt
gagcgcttcatcaaatgggacgatgaaacagcaagtgcttctcctgtgattctccgagtg
gatccgaagggcttttacttatactggacctatcagaataaggaaatggaaattttggat
ataaccagcatccgagatacccgagtagggcggtttgccaaaatccccaagtgccagaag
ctccgagaggtttttaacttggattaccctcacagcttcctgcttaagactctgactatc
gtatctggccctgacatggtggacctcactttccataactttgtgtcctacaaggagaat
gttggcaagagctgggctgaggatattatggccatcgttcggaatcccctcacgtacaac
gcttctcggtacaccttcctagagaaaatcctggtgaagctgaagatgcagcttaatgca
gaggggaagattcctgtcaggaatatttttcagatgtttcctgcagacaggaagagggta
gaagcagcattaagtgcttgtcatcttccaaagggcaagaatgatgccatcaacccagag
gacttccctgaaaccgtgtataaaactttcctcatgaatctgtgtccacggcctgagatt
gatgagatatttacctcacaccatttaaaagcaaagccctacatgaccaaagagcacttg
gcaaagttcatcaacaagaagcagcgagactctcgcctcaatgacatccttttcccacca
gccaaacctgagcaggtgcagagcctgatagagaagtatgagcccagtgggattaacatc
cagagagggcagttgtctccagaggggatggtctggtttctctgtggccctgagaacaat
gtgatagcactggacaaattggtgctgtaccaggacatgacccagccgctctcacactac
ttcatcaattcatcacacaacacgtatttaacagccggtcagttttctggtatctcctct
cctgaaatgtatcgccagacgctgctggctggctgccgctgcgtggagctggattgctgg
aagggccgacccccggatgaggagccgatcatcactcacgggttcaccatgacaactgag
atcctcttcaaggatgccattgaggccatcgcagaaagtgcttttaaaacatctctctac
cctgtcatcctgtcctttgagaaccatgtggactcgcccaagcagcaggcgaagatggct
gagtactgccgaaccatatttggcgatatgctgctgacggaaccactggaaaaataccca
ctgaagccaggagttcctctgccaagtcctaaggatctcttagggaaaatcttgattaag
aacaaaaaaaagcaatctgtatctgggaagagacagaactctttgaagaaagggaggaat
gtggaaccaggaatcatcgagcagccaacccctacggatgctgaagatactgtctgggca
ggtgatgtggttgaagaggaaccagaggaagaggaggaacatctcggaaacctggatgaa
gaggaaattaaaaagatgcagtcagatgagggcactgctggtttggaagtgacagcgtac
gaggaaatgtccagcctggttaattacatacagccgatcaaatttgactcctttgaagtc
tctgcccagaagaaccggagttacgtcatctcttcctttacggagctgaaggcttacgat
ctactaaccaagttccctgtgcagtttgtagaatacaacaagcgacagatgagccggatt
taccccaaaggcacccggatggactcctctaattacatgccccagatgttctggaacgtc
ggctgtcagatggtggcactcaacttccagaccatggatgtccccatgcagcagaacatg
gctctgtttgagttcaacggccagtgtggctatctgctcaagcatgaattcatgcggcgg
ccagacaagcagttcgaccccttctctgtggaccgcattgacgtggtggtggcaagtacc
ctgtctgtcacgatactctccggtcagttcctctcagatcgcagtgtgaagacatacgtg
gaagtagagctgtttgggttgccaagggacacaaaacgcaaatacagaaccaaactgacc
tccactgccaattccattaaccctgtatggaaagaggaggcttttgtttttgaaaagatc
atgatgcctgagttggcgtctctcaaaattgcggcttgggaggaaggagggaagttcatt
ggtcatcgcgtcattcccgttattgcaatgcactcaggctatcaccacgtttgtctccgc
agtgaaagtaacatgccgctcaccatgccttctctgtttgtgtacctggaaataaaggac
tacgttcctgatgcttgggcagatctgactattgctctctccaaccccattaagttcttc
agtctgcaagacaagagatcagttaagctaaaagacggctcggtggagaggcttggcaca
cagaggaacttcccatctgctgaaactaacgggataccagactccactgggaatttcagc
actcctctttctaatgggcctgcaggagcagcggcattccccaaggacgaaaatgtgata
gaagtgacgcagattgcagagcctcagacagccagcctcacagaactgcagcagatgaag
ctctttctgaagctgctgaagaagcaggagaaggaactgagggagctggagcggaaagga
agtaaacggagggaggagctgctgcagaaatattctgtactcttttcggagtctgtctgc
tatggaggcaagaaaaggatgatgcacgctaggaagacccagaagaagaggagtttgaca
acaggtgatgttggtacatgtgcaaatcctgtagaaatggcagaaagccttgatagccga
gttttggaactgagagagaggctggagatggacctcatccaactgggggaggaacaccat
gatgggattcgaagaaagaaagagcagcacgccacagagcaagttaccaagataatagag
ctagccagagagaagcagacagctgagctgaaggcactgaaggagtcatcagaaagcaat
attaaaaacattaagaagaagctggaggcaaagagagtggaccgaatccaagccatgatg
aggaatactagcgacaaggccgctcaggagaggttgaagaaagaaattaataactctcac
attcaggaagtggtgcaaacaatcaaacgggtgacagaaaagacagccaggtatcagcag
aaactggaagagaagcaggcagataatctgagaacaatcaaggagaaagaaagccagctg
cagcaggaggcactggcagagtatgaggagaaattgaaaagtctgaatatcgaggtgcag
gagatggtgaagaacttcgcaaaagcaggctttcctggagagccagagattcagaaggaa
gtagttcagagcattcctgagggagaaggcggctctacagaacaactggaagaaaagatc
ccagtggcagaggtctcgaggcttacaatagccatggctgagcccccaggagctgaaaca
gatgtcgagactgaagaaagcatattttga

KEGG   Nipponia nippon (crested ibis): 104022433
Entry
104022433         CDS       T05756                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04310  Wnt signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
Module
nni_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104022433 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104022433 (PLCB4)
   04371 Apelin signaling pathway
    104022433 (PLCB4)
   04020 Calcium signaling pathway
    104022433 (PLCB4)
   04070 Phosphatidylinositol signaling system
    104022433 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104022433 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104022433 (PLCB4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104022433 (PLCB4)
   04916 Melanogenesis
    104022433 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104022433 (PLCB4)
   04270 Vascular smooth muscle contraction
    104022433 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104022433 (PLCB4)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104022433 (PLCB4)
Membrane trafficking [BR:nni04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104022433 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104022433 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 104022433
NCBI-ProteinID: XP_009474434
UniProt: A0A091UP10
LinkDB
Position
Unknown
AA seq 1194 aa
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESNCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGTDLVNISFTFMVAENTE
IAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIETYEPDEDLKSKGVISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLRRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDVAEERNIHHNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAG
FGSGTDTKKGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQ
IDKVVAQYDKEKVSYEKMLEKAIKKKGGSNCLELKKETETKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEVLEKQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQQAN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccagttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcaactgtctcttccaa
gtggatgaatttggcttttttctgagctggaaaagtgaaggaaaggaaggacaggtattg
gaatgctccctaatcaacagtgttcgttttggagccgtaccaaaggatcccaaaatacta
actgcgcttgaggctgttggaaaatcagaaaatgagttggaaggacgaatagtgtgtgtt
tgcagtggcacagatctggtgaacatcagcttcactttcatggtagcggaaaacacggaa
atagccaagcaatgggtagaagggcttggatccatcatacataactttagagctaacaat
gtcagtccaatgacatgtcttaagaaacactggatgaagctggcctttctaacaaacaca
aatgggaaaattccagttaggagcattaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaggcacttaaagaattaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttatgagaaattttatgagctcactcaaaagatatgtccccgaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacacaaaaagagcaatgcagataattgagacatatgagccagatgaagac
ttgaagagtaaaggtgtcatatcaagtgatgggttttgcagatacttgatgtcagatgaa
aatgccccagttttcctagaccgtttggaattatatcaagaaatggatcatcctttggct
cattatttcatcagttcctctcacaatacgtatttaacaggcaggcagtttggtggcaag
tcttcggtggagatgtacagacaagtgcttttggctggatgcaggtgtgtcgagctggac
tgttgggatggcaaaggtgaagatcaagaaccaataataacgcatggaaaagctatgtgt
acagatatccttttcaaggatgtcattcaagccattaaggaaacagcatttgttacatca
gagtatcctgtcattctttcatttgaaaatcactgcagcaaatatcaacagtacaagatg
tcaaaatactgtgaagatctttttggagatctcctgttgaagcaacctctagaaacacat
ccacttgatccaggtaaagccttaccttctcctaatgacctcagaagaaagattcttata
aagaataaaaggctgaaacctgaagtagaaaaaaaacagctcgatgctctgaaaaagatg
atggaggctggggaaactgctgctcctgtaaatatcctagaggatgataatgaagaagaa
atagaaagtgctgaccaggaagaagaagctcatccagagtacaaatttggaagtgacctt
actgtagatgattacagtcaaaaagaagctgttgccatcagtgtcaaaaagggtttagta
actgttgaagatgaacaagcgtggatggcatcttacaaatatgtaggtgccacaaccaat
atacatccatatttatcaacaatggtcaactatgctcaacctgtaaaatttcaaggtttc
gatgtagcagaagaacgtaatattcatcataatatgtcctctttcaatgaatcagtggga
ctagggtatttgaagacccatgctattgagtttgtgaattataataaacgacaaatgagt
cggatatacccaaagggaggccgagtggattccagtaattacatgcctcaaattttctgg
aacgctggctgccagatggtctcactgaactatcagaccccagatttagcaatgcagttg
aatcaaggaaaatttgaatataatggatcatgcgggtatctacttaaaccagatttcatg
cgacgaccagatcgcacatttgaccctttctctgaaactcctgtagatggtgtaattgct
gcaacgtgttctgtacaggtaatatctggtcagttcttatcagacaaaaaaattggtacg
tatgtagaagtggatatgtatggtttacccacggacacgatacgtaaagaatttcgaaca
cgcatggtgatgaacaatggtctgaaccctgtttacaatgaagaatcatttgtgtttcga
aaggtcattctccctgatcttgctgtcctgagaatagcagtgtatgatgacaataataag
ttgattggtcagaggatcctgcctctggatggtctgcaagcaggttacagacacatttcc
cttcggaatgagggcaacaaaccactctctcttccaacggttttctgcaacattgtgctt
aaaacatatgtgcctgatggttttggagatattgtggatgctttatcagatccaaagaaa
tttttgtctatcacagaaaaaagagcagaccaaatgagagctatgggtatcgaaactagt
gatatagccgatgtaccaaatgacacttcaaagaatgatagaaaaggaaaagccaataat
gccaaagccaacgtaacgcctcagagtagctctgaacttcgaccgagtacgactgcaggc
tttggatctgggaccgacactaagaaaggtatagaccttattcctcaagtgaagatagaa
gatttaaagcaaatgaaggcttatataaagcatttgaagaaacagcagaaagagctgaat
gccttaaagaagaaacatgcaaaggagcacagcgctatgcagaagttgcactgcacacaa
attgacaaagtagtggcacaatatgataaagaaaaggtatcatacgagaaaatgttagag
aaggcaatcaagaagaagggaggaagtaattgtcttgaattgaagaaagaaacggaaact
aaaattcagacactaacatcagatcacaaatctaaggtcaaagagattgtggcacagcac
actaaagagtggtctgagatgatcaatacgcacagtgccgaagagcaagaaatccgtgat
ttacacttgaaccaacagtgtgaactactgaagaaactgctgattaacgctcatgaacaa
caaacccagcagctaaaattttcacatgacagggaaagcaaggaaatgcgtgccaaccag
gctaaaatatctatggagaacagcaaagccataagccaagacaaatccatcaaaaataaa
gctgaaagagagaggcgagtcagagaactgaacagcagcaacacaaaaaagttcctggaa
gagagaaaaaggctggcaatgaagcagtcaaaggaaatggatcagttgaaaaaagttcag
cttgagcatttagaagtcttggagaagcagaatgagcagcttttgaaatcctgtcatgca
gtgtctcaaacacaaggcaaaggagatgcagcagatggtgaagctggaagcagagatgga
tcgcaggccagcaacagtggtctaaagcctcaacaagcgaattga

KEGG   Nipponia nippon (crested ibis): 104022482
Entry
104022482         CDS       T05756                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04310  Wnt signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
Module
nni_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104022482 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104022482 (PLCB1)
   04371 Apelin signaling pathway
    104022482 (PLCB1)
   04020 Calcium signaling pathway
    104022482 (PLCB1)
   04070 Phosphatidylinositol signaling system
    104022482 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104022482 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104022482 (PLCB1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104022482 (PLCB1)
   04916 Melanogenesis
    104022482 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104022482 (PLCB1)
   04270 Vascular smooth muscle contraction
    104022482 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104022482 (PLCB1)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104022482 (PLCB1)
Membrane trafficking [BR:nni04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104022482 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104022482 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 104022482
NCBI-ProteinID: XP_009474485
LinkDB
Position
Unknown
AA seq 1219 aa
MAGAQPGVHALQLKPVCVSDTLKKGIKFVKWDDDSTVVTPIILRTDPQGFFFYWTDQNKE
TELLDISLVKDARCGKHARAPKDPKLRELLDAGNLGGRLENRMVTVVYGPDLVNISYLNL
VAFQEDIAKEWSDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFS
ADRKRVETALEACNLPSSRNDSIPQDDFTPDVYRVFLNNLCPRPEIDHIFSEFGAKSKPY
LTVDQMMEFINFKQRDPRLNEILYPPLKQEQVQQLIEKYEPNSNLAKKGQISVDGFMRYL
SGEENGVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRC
VELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPK
QQAKMAEYCRLIFGDALLMDPLEKYPLEAGVPLPSPMDLMYKILVKNKKKSHKSADGSAK
KKLSEQASNTCSDTSSMFEPSSPGAGEAEIESDDDDDYDDDCKKSSMDEGTAGSEAMATE
EMSNLVNYIQPVKFESFEVSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIY
PKGTRVDSSNYMPQVFWNAGCQMVALNFQTVDLSMQINMGMYEYNGKSGYRLKPEFMRRP
DKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTS
QGNAVNPVWEEETIVFKKVVLPSLACLRLAVYEEGGKFIGHRILPVSAIRPGYHYICLRN
ERNQPLTLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEV
KKEIDHGDAPSEANNEPRPTPAENGVNYTASLTPKPATQVVHSQPTPGSVKAPAKTEDLI
QSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTAKYNEIQND
YLRRRAVLEKTAKRDSKKRSETGSPDHSSSTIEQELAALDSEMTQKLVELKEKQQQQLLN
LRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNSQLKKLKETCEKEKKELKKKMDKKRQE
KITEAKSKDKNQMEEEKTEMIRSYIQEVVQYIKRLEDAQSKRQEKLVEKHKEIRQQILDE
KPKLQVDLDQEYQDKFKRLPLEILEFVQEAMKGKISEDGDHSSAPSSLASDSGKSNHKPL
QSEEELEEDNPEKVFDTTF
NT seq 3660 nt   +upstreamnt  +downstreamnt
atggccggggcacagccaggggtgcacgctctccagctcaagcccgtctgcgtctccgac
accctgaagaaaggcatcaaattcgtcaagtgggacgatgactccactgttgtgactcca
attattctcagaacagatccgcagggatttttcttttactggacagatcaaaataaggag
actgagctgctggatatcagccttgtcaaagatgccagatgtggaaaacatgccagagct
cccaaggatccaaaactgcgcgaactgttggatgctgggaacctaggaggtcgactggaa
aatcgaatggtaactgttgtctacggtccagacctggtcaatatatcgtacttgaacttg
gtggcattccaagaggatatagcaaaggaatggtcagatgaagtgttcagtttggcaaca
aatttgttggcacagaacatgtcaagggatgcatttctggaaaaagcttacacaaaactt
aagctgcaggtgactccagaagggcgcattcctctgaagaacatataccgcttgttttcg
gctgacagaaaacgagtagagaccgcattagaagcttgtaatcttccatcttccaggaat
gattcgatccctcaagacgacttcacgccagacgtgtacagggtgttcttaaacaacctc
tgccctcggcctgagatcgaccacatcttttcagagtttggtgccaagagcaaaccatac
cttactgttgatcagatgatggaatttataaattttaagcaacgtgatccacgattaaat
gaaatcctttatccaccgttaaaacaagaacaagttcaacaactcattgagaagtatgaa
cccaacagtaatctagcaaagaaaggacagatatcagtggatggatttatgcgatatctg
agtggagaagaaaatggcgttgttccacctgagaaactggatttaaatgaagatatgtct
caaccactgtcacactatttcatcaattcctcacacaacacctacctcacagctggacag
ctggccggtaactcatcggtggagatgtatcgccaagtgcttttgtcaggctgccgctgt
gtggagctggactgctggaaaggacgaacagctgaagaagagccggtcattacacacgga
ttcactatgacaactgaaatatccttcaaggaagtaatagaagctattgctgaatgtgca
tttaagacatcgccctttccaatcctcctttcctttgaaaatcatgtggattcccctaaa
caacaggcaaaaatggcagagtactgcagattaatatttggagatgcattgcttatggat
ccattggaaaaatacccgcttgaagctggggttcctcttccaagccctatggatttaatg
tacaaaattctggtgaagaataaaaagaagtcgcataagtctgcagatggaagtgcaaaa
aagaagctctcagagcaagcttccaacacatgcagtgatacgtctagtatgtttgaacct
tcctcccctggagcaggagaagcagagattgagagcgatgatgatgatgactatgatgat
gactgtaaaaagtcgtcgatggatgaaggtactgctggaagtgaggcaatggccaccgaa
gagatgtctaacctggtgaactacattcagcctgtgaagtttgagtcatttgaagtatca
aaaaaacgcaacaaaagttttgaaatgtcttcctttgtggaaaccaaagggcttgagcaa
cttacaaagtctcctgtggaatttgtggaatacaacaaaatgcagctaagccgaatttac
ccaaagggaacacgtgtagattcttcaaactacatgccacaagtcttctggaatgccggc
tgccaaatggttgctcttaacttccaaactgtagatttgtctatgcaaataaacatggga
atgtacgagtacaatggcaaaagcggatacaggttaaagccagaattcatgagaagacca
gacaaacactttgatccatttactgaaggtatagtggatgggatagtagctaacaccttg
tctgtcaagataatttcgggtcagtttctttctgataaaaaagtcggtacctatgtagaa
gtcgacatgtttggcctgcccgtggatacaagaagaaaagctttgaagaccaagacctct
caaggcaatgcagttaatcctgtctgggaagaggaaaccatagtgtttaagaaggtcgtt
ttaccttccttggcatgtttgaggctagcagtgtatgaagaaggagggaaatttattggt
catcggatattaccagtctcagcaattcgaccaggctatcactacatctgtttgaggaat
gagaggaaccaacctttgacactgccagctctcttcgtgtacatagaggtcaaagactat
gtacctgatacgtatgcagatgtgatcgaggccttatccaatccgatcagatatgtaaac
ttgatggagcagagagctaagcaactggctgcactgactctggaagatgaagaagaggta
aagaaagagattgaccatggagatgcaccatccgaagctaacaatgaacctaggccaaca
ccagcagaaaatggagtaaattacactgcctctcttacaccgaaaccagcaactcaggtg
gtccatagccaaccaacaccaggttcagtgaaagcacctgcaaagacagaagatcttatt
cagagcgtcctcacagaagtggaagcacagactattgaggagctaaaacaacagaagtct
tttgttaagcttcagaagaagcactacaaggaaatgaaggaccttgtaaagaggcaccac
aagaaaaccactgaccttatcaaagagcacactgcaaagtataatgaaatccagaacgac
tacctgcgacgaagagcagttttagaaaaaacagcaaaaagagacagtaagaaaagatct
gaaacaggcagcccagaccacagttcttcaactattgaacaggaattagctgcgctcgac
tctgaaatgacccagaagctagttgagctgaaggagaagcaacaacagcagctgctaaat
ctccgacaggagcagtattacagtgaaaagtaccagaaacgagagcacattaagctgctt
attcagaagttgacagatgtagcagaggagtgtcagaacagccagctaaagaaactgaaa
gaaacatgtgaaaaagaaaagaaagaattgaagaaaaaaatggacaagaagaggcaggag
aagatcacagaagcaaagtccaaggataaaaatcaaatggaagaagagaagactgaaatg
attcgatcatacatccaggaggtggtgcagtacataaaacggctagaagatgctcagagt
aaaagacaggagaaacttgtagaaaaacacaaggagattcgtcagcaaatactggatgaa
aagcctaagttgcaggtggaccttgatcaggaatatcaagacaaattcaaaagactgcct
ttggaaattctggagttcgtacaggaagccatgaaagggaaaatcagtgaagatggagac
cacagttcagccccctcttccctggcatctgacagtggaaaatcaaatcataaacctctg
caaagtgaagaggaattggaagaagataatccagaaaaagtatttgatactactttttag

DBGET integrated database retrieval system