KEGG   Nipponia nippon (crested ibis): 104020776
Entry
104020776         CDS       T05756                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04144  Endocytosis
nni04510  Focal adhesion
nni04540  Gap junction
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020776 (PDGFRA)
   04020 Calcium signaling pathway
    104020776 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104020776 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104020776 (PDGFRA)
   04540 Gap junction
    104020776 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104020776 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104020776 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nni04090]
    104020776 (PDGFRA)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104020776 (PDGFRA)
Protein kinases [BR:nni01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104020776 (PDGFRA)
CD molecules [BR:nni04090]
 Proteins
  104020776 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 104020776
NCBI-ProteinID: XP_009472521
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPWMFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPSAQVTLINSLDKAVYAFYDSKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccatggatgttcctgatcctgggatgttttctcacaggaccattccta
acattttgccagcttcctctgccgactattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacattagacatgaagaaaacaacagtggcctcttc
gtgacggtgcttgaagtaggaaatgcctcagctgctcatacgggcttgtatgtttgctat
tataaccacactcaagtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaagtgctcaagtgacttta
attaacagtttagacaaggctgtttatgctttctatgacagcaaacaaggcttcataggg
aatttccctgcgggctcatatacatgcaaaacaatggttaaaggcgtggagttcaagtct
gatgagtttctcatctatattttaagagctacttcacagctgccagttgaaattgaagct
cttaaaacggtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgataat
gaagtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggtttgttcacctggagcctcag
tttagccctctggaagctgtcaatctacatgaagtcaaaaattttgttgttgatgtgcag
gcatacccagctccaaaaatgtactggttgaaggataacgtgactctgattgaaaatctt
actgagattgttactagttcaaacagagtccaggaaacaaggtttcagagcatattaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctccttgctaatacaagttccagccctaatcttagacctt
gtggacgaccaccatggctctgcaggggggcagacggtgaggtgcttggcggaggggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatggactcttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaacatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgggaactgaagcttgtggctcccacc
ttgcgatcagaactaacggtggctgctgcagtcttagtgctgttagtgattgtgataatt
tcactgattgtgctggtcatcatatggaaacagaagccgaggtatgagataagatggaga
gtcattgagtctatcagccctgatggccacgaatatatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagacgggttagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtagttgaagggactgcatatggattgagtcgctctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgcttttacggt
gatttggtgaactatctgcataagaacagggacaatttcctgagccgacatccagagaaa
cccaagaaagatttggatatctttgggatgaacccagccgatgaaagcacaagaagttat
gtgatattatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtatgtgccaatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtatacgatcggcctgcttcatataagaagaaatctatgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcggagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaatttttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtcctcctggctcaaggaaaaatagtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagcactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccataccctggcatgatg
gttgattctactttctacaataagatcaagagtggataccgaatggccaaacccgatcat
gctaccaacgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagcgatcacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagttaaag
gacagggagagcggatttgatgagcagagactgagtgctgacagcgggtacatcatcccc
ctgcctgacatcgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctagtggaggacagcttcctgtaa

DBGET integrated database retrieval system