KEGG   Nipponia nippon (crested ibis): 104021609
Entry
104021609         CDS       T05756                                 

Gene name
CSNK1E
Definition
(RefSeq) casein kinase I isoform epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104021609 (CSNK1E)
   04340 Hedgehog signaling pathway
    104021609 (CSNK1E)
   04068 FoxO signaling pathway
    104021609 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104021609 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104021609 (CSNK1E)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104021609 (CSNK1E)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104021609 (CSNK1E)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104021609 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 104021609
NCBI-ProteinID: XP_009473477
LinkDB
Position
Unknown
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDMDRERREHEREERMGQLRGSATRALPPGPPAGATANRLRNVTEPMASTPTSRIQQSG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRISASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagcttcgagtggggaacaaataccgactgggcagaaagattggcagcggttcgttt
ggagacatttacctaggagccaatattgcgactggtgaagaggtggccatcaaactggaa
tgtgtcaaaaccaagcatccccagctccacattgaaagcaagttctacaagatgatgcag
ggaggagtgggtatcccctccattaagtggtgtggagcagagggggactataatgtgatg
gtgatggagctcttggggcccagcctagaagatctcttcaacttctgttcccgcaaattt
agtctcaagacagttctgctcctggcagaccagatgatcagccgtattgagtacattcat
tccaagaacttcatccaccgggatgtgaagccagacaacttccttatgggcctcggcaaa
aaaggcaacctagtatacatcattgattttggtttggcgaagaagtaccgagatgcccgg
acccaccagcacatcccctaccgggaaaacaagaatctgactggcacagcccgttatgcc
tctatcaacacccacctgggaattgaacaaagtcgccgagatgacctggagagcctgggc
tacgtgctcatgtatttcaacctgggctcgctgccctggcagggcctcaaggctgccacc
aagcgccaaaagtacgagaggatcagcgagaaaaagatgtcaacgcccattgaggtgctc
tgcaaagggtacccttctgagttctcgacatacctcaacttctgccgctcactgaggttt
gacgacaaacctgactactcgtacctgcggcagctcttccgcaacctcttccaccgccaa
ggcttctcctacgactatgtctttgactggaacatgcttaaatttggagcagcccggaac
cctgaggatatggatcgggagcggcgagagcacgagcgagaagagagaatggggcaactc
cgggggtcagccacacgagcgctgccccccggcccacctgctggagccactgccaaccgt
cttcgcaatgtcaccgagcccatggcctccacccccacctcccgaatccaacagtccgga
aacacgtcccccagagcaatctcaagagtggacagggagcggaaggtcagcatgaggtta
caccgaggagctcctgccaacgtctcctcatctgacctcacagggcggcaagaagtgtca
cggatttcagcatcacagacaagtgtgccatttgatcaccttgggaagtga

DBGET integrated database retrieval system