KEGG   Nipponia nippon (crested ibis): 104021637
Entry
104021637         CDS       T05756                                 

Gene name
EP300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04310  Wnt signaling pathway
nni04330  Notch signaling pathway
nni04350  TGF-beta signaling pathway
nni04520  Adherens junction
nni04916  Melanogenesis
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104021637 (EP300)
   04330 Notch signaling pathway
    104021637 (EP300)
   04350 TGF-beta signaling pathway
    104021637 (EP300)
   04068 FoxO signaling pathway
    104021637 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104021637 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104021637 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104021637 (EP300)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104021637 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104021637 (EP300)
   03036 Chromosome and associated proteins [BR:nni03036]
    104021637 (EP300)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104021637 (EP300)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     104021637 (EP300)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    104021637 (EP300)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    104021637 (EP300)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    104021637 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 104021637
NCBI-ProteinID: XP_009473508
LinkDB
Position
Unknown
AA seq 2443 aa
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLSLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGMLNS
MVKSPMAQAGLTSPNMAMGASGPNQGPSGQSTAXKPGMGMNTGMNAGMNPAMLAAGNGQG
MMQGQVMNGSIGAGRGRPNMPYPNPGMGSAGNLLAETLQQGSPQMGGQAGLRGPQPGAMN
KMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKAGLQNSLPQFPMDKKPVPGAGIPSC
GQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVR
QCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGD
KRNQQSLLGGAAVGLANTGSVGVGQQTTPSINTTSQIDPSSIERAYAALGLTYQGNQMQT
QPQAQVKNQQQGQSPQGLRPMNPMSANPMGVNGGVGVQTPNLLPDSMLHSTMNSQNPMMS
ESTNVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMIPNAPGMPQ
APMNQGPNMGQPQPGMSANGPLPDPTLIRANVPNQMMNRMQAQPGMNQFGQMNMQLSPMG
PRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQTQFPASSPGMNTASM
PMTQPGNQTPVSQAQMTSASCPVNSPAMAPGSQGSHIHCPPLPQPPMHRNSPSPVPSRTP
TPHHTPPGLGSQQQQAAAAAATAPTPTPQAMPPGPQSQTMHPPQRQTPTPPQAQLPPQVQ
PPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDGQVSNPPSTSS
TEVNSQQTVPEQQQPPLQEVKMDIKTEEGEPEQTELQMEEKPEVKVEPVMEECKPEPMEQ
EEKKSEVKTEIPEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPTLEALYRQDPES
LPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYN
RKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYY
SYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECIECGR
KMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENRVNDFLRR
QNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLC
FFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTT
GHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQATE
DRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDSKNAKKKN
NKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPI
VEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNE
CKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQSPGDSRR
LSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYH
AKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTP
ATPTTPTGQQPPTPQTPQPQPPPQPASQPQPAPPNSMAPYTMPRTQPPSAVSQGKAGGQV
TPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQMPPMGMN
PPQIGRGPGGHIDQGMGPAGIQQQPPWVQGSLPQAQLQPGMQRPPSMMSVAQPGQPMNMA
PQPGMGQVPGAAQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQ
RAAKYAGSQNPQGMTGQPGIPQGQPGLQPQQAMQGQQGGVHPNPAMQSMNPMQAGVQRPS
MPQQQPQQQPQQAMAGMNPQAQQMNMNHSGMAPQFRDLLMRRHQMIEQQRHQQQPQPQGA
GPALGPGMANHNQFQQPQGVGYPQQQQQQQQQQRMQHHMQQMQQGNMGQISQLPQAMSAE
TGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVRSPQ
PVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQSA
MLSQLASNPGMAGLHGTSATELGLSSENSDLNSNLSQSTLDIH
NT seq 7332 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactgtttgatctggaa
catgacttgccagatgaactgatcagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagaccagcctcagcctggcacaagatgctgcctctaaacacaagcag
ctgtctgaacttttacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccagggcatggccagtcaaacccaacaaaatagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaagctgggttgacttctcccaatatggcgatgggtgca
agtggaccaaaccagggtccttcaggccaatccacagcanggaaacctggcatgggaatg
aacacagggatgaatgctggcatgaatcctgcgatgttggcagcaggcaacggacagggg
atgatgcaggggcaagtcatgaacggttcaattggagcaggcagagggcgacctaatatg
ccatacccaaacccaggaatgggtagtgctggtaacttgttggctgagacactgcaacaa
ggctctccacagatgggaggacaggctggactgagggggccacagcctggagccatgaac
aagatgggaatgatgagcaatcccagcccttatggccagccatatagtcagaataccggg
cagcagattggagccagtgggcttgggcctcagatgcagaataaagctggactgcagaat
agtttaccacagtttccaatggacaagaagccagttcctggggcaggaatccccagttgt
ggccagcagcaggctccccaagttcaacaagctgggatggggccagcagcttctcaagga
atgggatctggagcaccgacagcggatccagaaaaacgcaaacttattcagcagcaactg
gttctgctcttacacgctcacaagtgtcagcggcgagaacaggccaacggggaggtgcga
cagtgtaacctccctcattgccgaaccatgaagaatgtcctgaaccacatgacacattgc
caggctggcaaatcttgccaggtggcacattgtgcgtcttcccgacaaatcatctcgcac
tggaagaattgtacgagacatgactgtcctgtatgtttgcctctcaaaaatgctggggac
aaaagaaatcaacaatcgctgctgggcggagctgcagtaggacttgcaaacactggctct
gtgggcgtggggcagcagacaacacccagcataaacactaccagtcagatagaccctagc
tccatcgagagagcctatgcagccctcggactgacctatcaagggaaccagatgcagacg
cagccccaggctcaagtgaagaatcagcagcaaggacagtcaccccagggtctgcgccct
atgaatcctatgagtgcaaatccaatgggagtgaatggaggagtaggggttcaaacccct
aatctgttgcctgactcaatgttacattcaaccatgaattctcaaaaccccatgatgagt
gaaagcaccaacgttgccagtttgggagccatgccaacagctcaaccatctaataccgga
attcgaaagcagtggcatgaagacattactcaggatctccgaaaccaccttgttcataaa
ttagtccaagccatatttcctactcctgaccctgcagcactgaaggatcggcgtatggag
aatctggtggcatatgctcggaaagtggaaggggatatgtatgaatcagcaaacagcagg
gcagagtactatcacttgctagcagagaagatctataagattcagaaggagttggaggag
aaacgaagaaccaggctgcagaagcaaaacatgatcccaaacgctccgggcatgccacag
gctcccatgaatcaagggcccaacatgggacagccccagccagggatgtctgcaaatggt
cctcttcctgacccaaccctgatacgtgccaatgtgccaaaccagatgatgaatcgcatg
caggcacagccaggaatgaatcagtttggccagatgaacatgcagctgtcaccgatggga
ccccggcaaacccctcctcttcagcaccctggacagctaagccaggcaggggccatgaac
cagatgggatttccttcgcgtatgcagcagccaggagttggccagccttctggtcagaat
cagtttctacaacagacccagttccctgcttcttccccgggaatgaacacagcgagcatg
cctatgactcagcctggcaatcagacaccagtttctcaagcacaaatgaccagcgcttcc
tgtcctgtgaactctcctgcaatggctccaggttctcaagggagccatattcactgccca
cctcttccacagcctcccatgcaccgaaattctccttctccagtacctagtcgaacccca
acacctcaccacacacccccaggcttgggatcacagcaacagcaggcagcagcagctgcc
gctactgcccccacacctactcctcaggcaatgccacctggaccacagtcgcaaactatg
cacccccctcagaggcagactccaacgcctccgcaggcacagctgcctccacaagtccag
cctccagttccagttaccccttctgcagagcagcaacagcaacccttatcacagcagagc
acgactgcatctgttcccacaccaacagcaccgttgcagcctcagcatcccacaacacct
ctttcacagccagctgtaagcattgacgggcaggtatccaaccccccatctaccagcagc
acagaggtgaactctcagcagactgttccagagcagcagcagccacccttgcaggaagtg
aaaatggatattaaaacagaagaaggggaaccagaacaaacagaactgcaaatggaggag
aaacctgaggttaaagtagaaccagtcatggaggaatgtaaaccagaaccaatggagcaa
gaagagaagaaatctgaagtgaagactgaaataccagagggggaagaaagacctactact
ccagctactcagtcttctccggcagctgggcagtctaagaaaaaaattttcaaaccagaa
gagttgcggcaggcgcttatgccaacactggaggcactttaccgtcaggatccagagtct
cttccatttcgacagcctgtggatccccagctactaggaattcctgattattttgacata
gtgaagaaccccatggacctttctactatcaagaggaagctagacacaggacagtatcag
gaaccgtggcaatatgtcgatgacatctggctcatgttcaataatgcctggctgtataac
cgcaaaacatcccgggtatataagtactgttccaaactggcagaggtgtttgagcaagaa
attgacccagttatgcagagccttggttattgctgtggaagaaagttggagttctcacca
cagactttgtgttgctatggcaaacagctatgcacaatccctcgagatgccacttactac
agttaccagaacaggtatcacttctgtgagaagtgcttcaacgaaatccaaggggagagc
gtttctctgggagatgacccatcacaacctcaaaccacaataaacaaagaacagttttca
aaaaggaaaaacgatacactggaccctgaactatttgttgaatgtatagagtgtggaaga
aaaatgcaccagatctgtgttcttcataatgagataatctggccttctggctttgtctgt
gatggctgtctaaagaaaacaggacgaaccaggaaggagaacaaattctctgctaaaaga
ttaccggctacaagacttggtaccttcttggagaacagagtcaatgatttcttaagacga
cagaatcaccctgaggcaggagaggttacagttagggtggtacatgcatctgacaaaact
gtcgaagtaaaaccaggaatgaaagcaaggtttgtagacagcggagagatggctgagtct
ttcccttatcgaacaaaagcgctttttgcctttgaggagattgatggtgtagacttgtgc
ttctttggcatgcatgtacaggagtatggttcagactgtcctccacccaatcaaaggcga
gtgtatatatcttaccttgacagtgttcatttcttccgccctaaatgcttgaggactgct
gtctatcacgaaatactaattggatatctagaatatgtcaagaaactagggtatactact
ggacatatctgggcatgcccacctagtgaaggagatgactacatcttccactgccatcct
cctgaccaaaagatacccaaacccaaacgactgcaagagtggtacaaaaagatgctggac
aaatctgtgtcggagcgcattgtccatgattacaaggatatatttaagcaggcaacagag
gatcgtctaacaagtgcaaaagagctaccttacttcgaaggggatttctggcctaacgtt
ctagaggagagcattaaggagctagagcaagaggaagaagaacggaagagagaagaaaac
actagtaatgaaagcacagatgtgagcaagggagacagcaaaaatgccaaaaagaagaac
aataagaagacaagtaagaacaagagcagcttgagtcgtggcaataagaaaaagcctggc
atgcccaatgtgtccaatgacctctcccaaaagctgtatgccactatggagaagcacaag
gaggtcttctttgtcatccgtcttattgctggccctgcagccaactccctgccccccatc
gttgagcctgacccactcattccgtgcgacctgatggatgggcgtgatgctttcctaacc
cttgctagagacaagcacctggagttctcctcactacgacgggcgcagtggtcaaccatg
tgcatgctggtggaactgcatacccagagccaagaccgctttgtttacacctgcaatgag
tgcaagcatcatgtggagaccagatggcactgcactgtttgtgaggattatgacctgtgc
atcacctgctataacactaaaaaccatgaccacaagatggaaaaattaggccttggtcta
gatgatgagagcaacaaccagcagactgcaaccacccagagccctggtgattcccgccgc
ctgagcattcagcgctgtatccagtctctggtccatgcctgccagtgtcgtaatgccaac
tgctcactgccatcctgtcagaagatgaaacgggttgtccaacacaccaaaggctgcaaa
cgcaaaaccaacggagggtgccccatctgcaagcaactcattgctctctgctgctaccat
gcaaagcactgccaggagaacaagtgcccagtgcccttctgcctcaacattaaacacaag
ctccgtcaacagcagcttcagcaccgcctgcagcaggcacagatgctccgaaggaggatg
gcgagtatgcagcggaccggtgtggtaggccagcagcaaggattaccctcaccgacgcca
gccaccccaacgactccaacaggccagcagcccccaacaccacaaaccccacagccccag
cctccgccccagcctgcctcgcagcctcaacctgcacctcccaacagtatggcgccctac
accatgccaagaactcagccccccagcgctgtgtcccagggcaaagcaggtggccaggtg
actcctccaactccaccccagccaccgcaaccaccagttcagggtcctcctccagcagca
gtggaaatggccatgcagatccagcgggcagcagagacccagcgtcagatggcacaggtt
cagatcttccaaaggccaatccagcaccagatgccccagatgccgcctatgggaatgaac
cctccgcagataggcagaggtcctggtggtcatatagatcaaggaatggggccggcagga
atccagcagcagccaccgtgggtgcagggcagcttaccccaagctcagctacagccagga
atgcagaggccgccatccatgatgtcagtagcccagccaggtcagccgatgaatatggca
cctcagccagggatgggtcaggtacctggcgctgctcagcccaaacaaccacctctgccc
caggcggccttacaaaacctgctgcggactctcaggtctcccagctcacccatgcagcag
cagcaggtgcttaacatccttcactccaatccccagctgctggccgctttcatcaagcag
cgggctgccaagtatgcgggctcccagaacccccaggggatgacgggtcagcctggcatc
ccccagggtcagccgggcctccagccgcagcaggccatgcaagggcagcaaggaggggtg
caccccaacccagccatgcagagcatgaaccccatgcaagcgggagtgcagaggcccagc
atgccccagcagcagccgcagcagcagccgcagcaggccatggctgggatgaatcctcag
gcgcagcagatgaatatgaatcactcggggatggctccccagttccgagacctcctgatg
agacggcaccagatgattgagcagcagcgccaccagcagcaaccgcagccgcagggagca
gggccagcactggggccggggatggccaaccacaaccagtttcagcagccccagggcgtc
gggtatccccaacagcagcagcagcagcaacagcagcaacgaatgcagcatcacatgcag
cagatgcagcaaggaaacatgggacaaataagccagcttccacaggcgatgagtgcagag
acaggagccagtttgcagcaggctttccagcagaggctacttcagcagcagatggggtcc
ccagctcagcccaatcctatgagcccccaacagcacatgctccccaatcaggcccagtcc
ccgcacctacagggccagcagctcccttcatcgctcaccaatcaagtgcgttctccgcag
cctgtaccctcaccacggccccagtcccagcccccccattccagcccgtccccccggatg
caacctcagccttctccacaccacgtctccccgcagaccagctccccacatccaggactg
gtagctgcccaggctaaccccatggatcaagggcactttgccagcccggaccagagtgca
atgctttcccagcttgctagcaatcccggcatggcaggcctccatggtacaagcgccacg
gaactggggctcagctccgagaactcagacttgaattcaaacctttcacagagtacacta
gacatacactag

KEGG   Nipponia nippon (crested ibis): 104023464
Entry
104023464         CDS       T05756                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04310  Wnt signaling pathway
nni04330  Notch signaling pathway
nni04350  TGF-beta signaling pathway
nni04520  Adherens junction
nni04916  Melanogenesis
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104023464 (CREBBP)
   04330 Notch signaling pathway
    104023464 (CREBBP)
   04350 TGF-beta signaling pathway
    104023464 (CREBBP)
   04068 FoxO signaling pathway
    104023464 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104023464 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104023464 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104023464 (CREBBP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104023464 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104023464 (CREBBP)
   03036 Chromosome and associated proteins [BR:nni03036]
    104023464 (CREBBP)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104023464 (CREBBP)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     104023464 (CREBBP)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    104023464 (CREBBP)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    104023464 (CREBBP)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    104023464 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 104023464
NCBI-ProteinID: XP_009475569
LinkDB
Position
Unknown
AA seq 2302 aa
MGKSPLNQGDSSASGLAKQAASTSGPTTPASQTLNSQAQKQVGMVTSSPATSQTGPGICM
NTNFSQTHQSLLNSNSGHSLMNQPQQGQGQMAGHTGLNTAQTGAMTKMGMTGNTSPFGQP
FSQTGGQQMGATGVNPQLPNKPGMANSLSPFPADIKSTPVTSVPNMSQMQTQVQQVGIVP
TQTMATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMT
HCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGIQNS
IGSVGTGQQNTPSLSNPNPIDPSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQ
QMRTINALGANQMNLPAGGITTDQQASLISETALPTSLGTNNPLMNDGTNSGNVGNLSSM
PTAAPPSSTGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVE
GDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGMLGNQPALQTPGPQPPGIPQ
VAAAMGQAQPVRPPNGPMSMPTVPISRMQVSQGMNQFNPMSIGNVQMPQAPMGPRAASPM
NHPVQMNNMGAVPAMAMSPSRMPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASSGAMN
VNNVGMGQSTAQAGVAQQGQVPSAALPNSMNMLGPQSGQLPCPPVTQPPLHQTTPPVSTA
AGMPPIQHQTPTGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQ
AQVTPQPQTPVQPQSVPTPQPSQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADT
NSQQLGPDAPMLESKSEVKTEETEPETSETQVEAKTEVEEDLQGSSQIKEETDGTELKQE
PMEVEEKKPEIKVDAKEEEESGTNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQ
DPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNA
WLYNRKTSRVYKFCTKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRD
AAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCK
ECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNK
FLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDG
VDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKL
GYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFK
QATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKN
AKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVIN
TLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFV
YTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSP
QESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIA
LCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPS
PTSATPGTPTQQPSTPQTPQPPPQPQPSPVSMSPAGFPSVSRTQPPTTVSTGKPANPVSA
PPPPAQPPPAAVEAARQIEREAAQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVNQMPQV
SMNVPRPNPVSGPVMSNMQPGQWQSPPMPQQQPMQPGMARPVMPMATPQAVAGPRMPGVQ
QPPRSIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQ
PQAGIQPQPGMQQPQTGMQQPGMHAQAGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQA
INIMNPGHNPSMANMSPQYREILRRQLLQQQQQQQQQQGGAGMAGGMAGHNQFQQPQGPG
GYPQAMQQQRMQQHISIQGGSMGQMAQMGQLNQMGQPGMGADGTPNIQQALQQRILQQQQ
MKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPH
SSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSAL
SNELSLVGDTTGDTLEKFVEGL
NT seq 6909 nt   +upstreamnt  +downstreamnt
atgggtaagagccctttaaaccagggagactcttctgcttcaggcctggcaaagcaagca
gccagcacctccggacctaccacacctgcatcacaaactctgaactctcaagcacaaaaa
caagtggggatggtgacaagcagccctgcaacatcacagactggacctgggatatgtatg
aatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcacagttta
atgaatcagcctcagcaaggacaagggcagatggctggtcacaccggactgaacacagca
cagacaggagcaatgactaaaatgggaatgacaggtaacactagtccctttgggcagcct
ttcagtcaaactggagggcagcagatgggagctacaggagtgaatcctcagttaccaaac
aagccaggcatggcgaatagtctgtctccctttcctgccgacatcaagagtactcccgtc
accagtgtgccaaatatgtcccagatgcaaacccaggtacagcaagtggggatcgtaccg
acgcagacaatggcaactggaccaaccgcagatccagagaagcgcaaactgatccagcag
cagttggttttgctgcttcacgctcacaaatgtcagaggcgtgagcaagcaaacggagag
gtgcgggcctgctctctcccgcactgccgaaccatgaaaaacgtcctcaaccacatgaca
cactgtcaagccgggaaggcctgtcaagttgctcattgtgcatcttcgagacaaatcatc
tcccactggaagaattgtactcggcacgactgtcctgtgtgccttcctttgaaaaacgcc
agtgacaaaagaaatcaacaaccccttctagggtctccagctggtggaatccaaaattcc
attggttctgttggcacaggccagcagaatactccatcgctaagtaatcctaatccgatt
gaccccagctccatgcaacgagcctacgctgctcttggactgccatatggcaaccagcct
caaacacagttgcagccccaggtacaaggccaacagccggcacagcctcaggctcaccag
caaatgaggaccattaatgcactgggagccaaccagatgaaccttcccgcaggaggaata
acaacagaccagcaagctagcctaatttctgaaacagctcttccaacatcccttgggaca
aataacccactaatgaatgatggcacaaattctggcaatgttggaaacctcagctcaatg
ccaacggctgcacctccttctagtaccggggtaaggaaagcatggcatgaacatgtcact
caggacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccactcctgat
ccggcagcactgaaggatcgccgcatggagaacttggtggcttatgccaggaaagtggaa
ggagatatgtatgaatctgctaacagtagggatgaatattatcatttattagcagagaaa
atctataagatacagaaggagctagaagagaaacggaggtctcgtctacataaacaaggg
atgttggggaatcagccagccttacagaccccaggacctcagccccctggtatcccgcag
gtggctgctgccatgggccaggcacagcccgtgaggccgcccaatgggcctatgtccatg
ccaaccgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagtttaaccccatg
tccatagggaatgtacagatgccacaagcacccatgggaccccgtgcagcttctccaatg
aaccaccctgtacaaatgaacaacatgggcgctgttcctgcgatggcaatgtctccttcc
cgaatgcctcagccgcagaacatgatgggagctcattccaacaacatgatgggtcaggct
cctacccagaaccagttcctgccccagaaccagtttccagcatccagtggggccatgaat
gtgaacaatgtgggcatgggtcaatcaacagcccaggccggggtggcacagcaggggcag
gttcccagtgctgctcttcccaactccatgaacatgctaggaccgcagagtgggcagtta
ccgtgtccaccagtgacccagccacctctacatcagactacacctcctgtgtccaccgct
gctgggatgccacctattcagcaccaaacgccaactggaatgactcctcctcagccagca
gcacccactcagccttcgacaccggtctcatcttcaggacaaacaccaacaccgacaccg
ggttccgttccaaacgcaacacagacacaaagcacgcctacggggcagactgcggcacag
gctcaagtcacaccgcaacctcagaccccagttcaaccccagtctgtgccaaccccacag
ccatctcagcaacagccaacatctgtgcaggcacagccacctggcactccactatcccag
gcagcagctagtattgataacagggtccccacccctgcctcagttgctagtgctgatacg
aattcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaaact
gaagaaactgagccagagactagtgagacacaagtggaagctaagactgaggtggaggag
gatttgcaaggatcttcacaaataaaagaagaaacagatgggacagaactgaaacaggag
ccaatggaagtagaagaaaagaagcctgaaataaaagtagatgctaaagaggaagaggag
agcggcactaatggaaccacttcacaatccacatcgccatctcagccccgcaaaaaaatt
ttcaaaccagaggagctgcgccaggctctcatgcctacccttgaagctttgtaccggcag
gacccagagtctctaccttttagacagcctgtggatccccagcttttagggattccggat
tacttcgacattgtgaagaatcctatggatctttcaaccattaaacgtaaattggatact
ggacagtaccaagaaccctggcaatatgtggacgatgtttggctaatgtttaacaatgcc
tggctttacaatcgcaagacttccagggtctataagttttgcactaaactggcggaggtg
tttgaacaagaaattgatcccgttatgcaatcacttggctactgttgtgggcgcaagtat
gagttttctccacagaccttgtgctgctacggcaagcagttgtgtactattcctcgtgat
gctgcctactacagttaccagaataggtatcacttctgtgagaagtgtttcactgaaatc
cagggggagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatctctaag
gatcagtttgaaaagaagaaaaatgatacactagatccagagccgtttgttgactgcaaa
gagtgtggtcggaagatgcaccagatttgtgtattacattatgatattatttggccttca
gggtttgtctgtgataattgtctgaagaaaactggtagaacacgcaaagaaaacaaattc
agtgctaaaaggctacagactacgcgtttaggaaaccatttggaagacagagtaaacaaa
tttttgcggcgacagaatcatcctgaagctggagaggtctttgtcagagtagtagcaagt
tcagataagacagtagaagttaaaccaggaatgaaatccagatttgtggattctggtgag
atgtcagaatctttcccttaccgtaccaaagctctgtttgcatttgaggagatagacgga
gtagatgtgtgcttctttggcatgcacgtacaggagtatggctcggattgcccccctcca
aatacaaggcgtgtgtacatatcgtatctagatagtattcatttcttccgcccccgttgt
ctccgaactgcagtttatcatgaaatcctcattggatatttggaatacgtgaagaaactt
gggtatgtgacaggtcacatctgggcctgtcccccaagtgaaggagatgactatattttt
cattgccatccacctgatcagaaaatacccaaacccaaacgtttgcaagaatggtataag
aagatgctggataaggcatttgctgagagaatcattcatgactacaaggacatcttcaaa
caagcaactgaggacaggctgacaagtgccaaggagctgccttactttgaaggtgatttc
tggcccaatgtgctggaagaaagcattaaggagttggagcaggaggaagaggaaaggaaa
aaggaagaaagcactgcagctagtgaaacaacagagggaagccagggcgacagcaaaaac
gccaagaaaaagaacaacaagaaaaccaacaagaataagagtagcatcagcagagctaac
aagaagaagcccagcatgccaaatgtgtccaatgatctgtctcagaagctgtatgccact
atggagaagcataaagaggtcttttttgtgattcatttacatgctgggcctgtaattaac
actctgcctcccattgtggaccctgacccattacttagctgtgatttaatggatgggcga
gatgccttcctcaccttagccagagataagcactgggagttctcctcactacgccgatcc
aagtggtccacgctctgcatgctggtagaactacatactcaagggcaggatcgctttgtc
tatacgtgcaatgagtgcaaacatcatgtggaaacaaggtggcattgcactgtctgtgag
gactacgacctctgcattaactgctacaacactaagagccatgaccacaagatggttaag
tggggcctgggtctggatgatgagagcaacagccaaggagagcagcagtcaaagagcccc
caggagtcgcgacgactgagcatccagcgctgcattcagtcccttgtccatgcctgtcag
tgccgcaatgcaaactgctcattgccatcctgccagaagatgaaacgggttgtccagcac
accaagggttgcaagcgcaagaccaacggtggctgtccggtgtgcaaacagctcatagct
ctttgctgctaccatgccaaacactgccaagagaacaaatgccctgtgccattctgtctc
aatatcaaacacaaacttcgacagcagcagatccagcaccgcctgcagcaggctcagctc
atgcgcagaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttgccttct
cctacctcagcaacgcctggtacccctacacagcagccaagtacaccgcaaacaccgcag
cctcctccccagccccagccttcccctgtaagtatgtcaccggctggctttcccagtgtg
tcgagaactcagccccctactactgtttcaacaggaaaacctgcaaacccggtttccgca
cctccgcctccggctcagcctccgccggccgcggtggaagcggctcggcagattgagaga
gaagctgcccagcagcagcagcagctctacagggtcaacaacattaacaatggtttgcct
cctggtcgcccaggactagtaaacccgacggtgggttcagtgaaccagatgccgcaagtc
agcatgaatgtaccccggcccaaccctgtaagcggtcccgtgatgtccaacatgcagccc
ggacagtggcagtcacctccaatgccgcagcagcaaccaatgcagccaggaatggcgaga
ccggttatgccaatggcgacgccacaagcggtggctgggccaaggatgccgggcgtgcag
cagccgccccggagcatccccccaaatgcacttcaggacttactgaggaccttgaaatca
ccaagttctccgcagcagcaacagcaggttcttaatatccttaaatccaaccctcagctt
atggcagcttttataaagcaaagaacagccaaatacgtggctaaccagcctgggatgcag
ccgcaagcaggcatacagccccagcctgggatgcagcagccgcagaccggcatgcaacag
ccaggcatgcacgctcaagcaggattgcagaacatgaacgcgatgcaagcaggagtgcag
agaccgagcgttcctccccagcagcaagggataggagctatgaatccccagggacaagcg
ataaacattatgaaccccggccacaaccccagcatggcaaacatgagtccgcagtacaga
gaaatactgaggcggcaattactgcagcagcagcagcaacagcagcagcagcaaggcggg
gctggcatggcaggagggatggcaggacataaccagttccagcagcctcaaggaccagga
ggttaccctcaagccatgcagcagcagcggatgcagcagcatatatcgatacaggggggg
tccatgggacagatggctcagatgggacagctgaaccagatgggccagcccggcatgggg
gcggacggcactcccaacatccagcaagcactgcagcagcggatcctgcaacagcagcag
atgaaacagcagatagggtcccccggccagcctaaccccatgagcccacagcagcacatg
ctctcaggacaaccgcaggcgtctcatctccctggccagcagatcgccacctccctcagc
aaccaggtgcggtccccagcacccgttcagtctccccgtccccagtcccagccaccacat
tccagcccgtcacccaggatacagccccaaccgtcacctcaccacgtctctccccagact
ggttccccccacccaggactcgcagttactatggctagctccatggatcagggacacttg
ggcaacccagaacagagtgcaatgcttccacaactaaacaccccgaacaggagtgcgttg
tctaacgaattgtctctggtcggtgacaccaccggggacacattagaaaaatttgtggag
ggtttgtag

DBGET integrated database retrieval system