KEGG   Nipponia nippon (crested ibis): 104022203
Entry
104022203         CDS       T05756                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04020  Calcium signaling pathway
nni04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104022203 (CAMK4)
   04020 Calcium signaling pathway
    104022203 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104022203 (CAMK4)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104022203 (CAMK4)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   104022203 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal FTA2 APH
Other DBs
NCBI-GeneID: 104022203
NCBI-ProteinID: XP_009474157
LinkDB
Position
Unknown
AA seq 354 aa
MIHSMHRTSRGFSRVVIALIVGGITWNGATSIVYRCRQKGTQKPYAVKMLKKTVDKKIVR
TEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQ
ILEAVAYLHANGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEDQVTMKTVCGTPGY
CAPEILRGCAYGPEVDMWSLGIITYILLCGFEPFYDERGDQYMFKRILNCEYDFVSPWWD
DVSLNAKDLVKKLIVLDPKKRLTTLQALQHPWVTGKAANFAHMDNAQKKLQEFNARRKLK
AAVKAVVASTRLGSASSHSAHDSNKPSRNPSPVHDSKPEEKPTQEAEAAPEEMS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgatacattccatgcacaggacatcacgaggtttctcacgagttgtcattgccctcatt
gtaggcggcatcacatggaatggggctacatccattgtctacagatgcaggcagaaaggg
acccagaaaccttacgccgtcaaaatgttgaagaagacagtagacaagaaaatcgtccgc
acggaaattggagttcttcttcgcctttcacatccaaacattataaaactgaaggagata
tttgagacccctacagaaatcagtcttgttctggaattggtcacaggtggagaactattt
gacaggattgtggaaaagggttactacagtgaacgagatgctgctgatgctgttaaacaa
atcctggaggcggttgcttacctgcatgcaaatggcattgtgcatcgtgacttgaagcca
gaaaatctactctatgcaacgccagcaccagatgcaccactaaaaattgctgactttgga
ctttccaagattgtggaagatcaggtgaccatgaagacagtttgtggaactccagggtac
tgtgcaccagagatattacggggatgtgcctacggccctgaggtggacatgtggtcgctg
gggattatcacctacatcctactttgtggctttgaaccattttatgatgaaaggggagat
cagtacatgtttaagagaatcttgaactgtgaatatgactttgtgtccccctggtgggat
gacgtgtctctgaatgccaaggatttagttaaaaagttgattgttttggaccccaagaaa
cgcctcaccactctacaggctttgcagcacccatgggtcacagggaaggcagcaaacttt
gcacatatggacaatgcacaaaagaaacttcaagaattcaatgcccggcgtaaacttaag
gctgcagtaaaagctgtggtggcatcaactcgcctcggcagcgccagcagtcacagtgcg
cacgacagcaacaagcccagccgtaacccgtctcctgtccatgacagcaaacccgaagag
aaacccactcaggaagctgaagcagctccagaagaaatgtcttag

DBGET integrated database retrieval system