KEGG   Nipponia nippon (crested ibis): 104022264Help
Entry
104022264         CDS       T05756                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00010  Glycolysis / Gluconeogenesis
nni00030  Pentose phosphate pathway
nni00051  Fructose and mannose metabolism
nni00052  Galactose metabolism
nni01100  Metabolic pathways
nni01200  Carbon metabolism
nni01230  Biosynthesis of amino acids
nni03018  RNA degradation
Module
nni_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104022264 (PFKP)
   00030 Pentose phosphate pathway
    104022264 (PFKP)
   00051 Fructose and mannose metabolism
    104022264 (PFKP)
   00052 Galactose metabolism
    104022264 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104022264 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104022264 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nni03019]
    104022264 (PFKP)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104022264 (PFKP)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104022264 (PFKP)
Messenger RNA biogenesis [BR:nni03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104022264 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 104022264
NCBI-ProteinID: XP_009474239
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVKAKVYFVYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAYNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPATPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFVEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKMFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFLFIIETMGGYCGYLANMGALAAGADAAYIFE
EQFDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKN
VLGHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTDDSVCLLGMRRRN
LVFQPVAELKNETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKE
AETGAI
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccaaccgaagttcttcgagaacctctcgggcaccgggaaggccatcggggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaaagccaaagtgtatttcgtttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcgagtatcctgcaagtggga
ggtacagttattggtagtgcacgctgcaaatcctttcgtacccgggagggccgcttgcag
gcagcctacaacttggttcagagaggaatcactaatctttgtgtgattggtggagatggt
agcttaactggtgccaatctgttccgtgaagaatggagtggacttctagaggaactggca
caaaaaggaaagattgatgaagaggctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctttgcacagaatcattgaagttgtggatgccatcatgaccactgctcaaagccatcag
aggacatttgttctggaggttatggggagacactgtgggtatctagctcttgttagtgcc
ttagcctgtggtgcagattgggtatttattcctgaatacccaccagaagaaggatgggaa
gattcaatgtgtgttaagctttcagagaatcgtgcacgaaaaaaaaggctcaatattatt
attgtagctgaaggagctattgattgccacaacaaacctataacgtcagagaaggttaag
gatcttgtggttcaacggctcggttttgacacacgggtaactatcttgggtcatgtgcaa
agaggtggcaccccttcagcttttgacagaattttggcaagtcgtatgggtgtggaagct
gtgcttgcccttttagaagctactccagctacccctgcctgtgtcgtgtctctgtctgga
aaccaggctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgagggaagatttgttgaggctgtgaggcttcgtggaaggagctttgaaaac
aaccttaacacctacaaattactgtcgcacaaaaaaccagatgccgagcttccaaagact
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgctgcagtg
agggctgcagtgagagttggcataactgaaggccataaaatgtttgccgtcattgatgga
tttgaaggttttgctagagggaagataaaggaaatcagctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatatttggag
aagattgctgaccagatgcgcactaacaacattaatgcccttatggttattggtggattt
gaggcgtacctgggacttctggaattgtcagctgcccgagagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgatcgcatcaaacagtcg
gccagtggtaccaagcgtcgtgtttttttattcatcattgagaccatggggggttactgt
ggttatctggctaatatgggggcccttgcggcaggagctgatgctgcttatatctttgaa
gaacagtttgatattcgagagctccaggctaacgtggaacacttgactgaaaaaatgaaa
accagtatccagcgtggtctagtgctgagaaatgagaactgcaatgagaactacacaact
gacttcatttatcagctgtattctgaagaaggaaaaggagtgtttgactgtcgaaaaaat
gtattgggccacatgcagcagggtggtgcaccttcaccatttgatagaaacttcgggaca
aaaatttctgcaaaagctatgcagtggatctccaaaaaactgaaggaaacctaccgaaaa
ggaaaagtatttgccaataccgatgactcagtttgtttgctgggaatgcggagacggaac
cttgttttccaaccggtggctgagcttaagaatgaaacagactttgtacacaggattccc
aaggagcaatggtggctgaagctgcgaccactgatgaaaatcctggccaagtacaagact
agttacgatgtttcagattcaggccagctggaacatgtcgctatgcacagcccaaaggaa
gcagaaaccggagccatctaa

DBGET integrated database retrieval system