KEGG   Nipponia nippon (crested ibis): 104022320Help
Entry
104022320         CDS       T05756                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00480  Glutathione metabolism
nni00980  Metabolism of xenobiotics by cytochrome P450
nni00982  Drug metabolism - cytochrome P450
nni00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104022320
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104022320
   00982 Drug metabolism - cytochrome P450
    104022320
   00983 Drug metabolism - other enzymes
    104022320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nni02000]
    104022320
Enzymes [BR:nni01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104022320
Transporters [BR:nni02000]
 Other Transporters
  Pores ion channels [TC:1]
   104022320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_C_5 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 104022320
NCBI-ProteinID: XP_009474304
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
MRFCPFAQRTRLVLRSKGISHEVININLKNKPDWFFEKNPFGLVPVLETSKGQLIYESPI
TCEYLDEAFPGKKLMPSDPYERAFQKMLLEHFSKITPLVFKYFVAVKDGQDATALKAEIA
EKFGKLEEILSKRNTVFYGGDSVSMIDYMIWPWFERLEPFQLKDSLSHTPKLQRWMEAMK
EDPAVKATMTDPQTFKGYLQLYVKNSPEACDYGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcggttctgccccttcgcccagaggacgcgcctcgtcctccgctccaagggcatcagc
catgaagtaatcaacatcaatctgaagaacaaacctgactggttctttgagaagaacccc
tttgggctggttcctgttctggagaccagcaagggccagctgatctatgagtccccaatc
acttgcgaatatttggatgaagcatttccagggaagaagttgatgccttcagacccatat
gagcgagcctttcagaagatgctcttggaacacttctcaaagataacacccctagttttc
aagtattttgtggcagtcaaagatggacaggacgccacggcactgaaagcagagattgct
gaaaagttcggcaaacttgaagagattctatccaaacgtaacactgtgttttacggtggg
gattcagtctccatgattgactacatgatctggccatggtttgaacgtctggaaccattc
cagctgaaggactctctgagtcacaccccaaagctccaacgctggatggaggccatgaag
gaggaccctgctgtcaaggctacaatgactgacccacagacattcaaaggttacctccag
ctctatgtgaagaacagccctgaggcatgtgactacgggctctga

DBGET integrated database retrieval system