KEGG   Nipponia nippon (crested ibis): 104022929
Entry
104022929         CDS       T05756                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04540  Gap junction
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
nni05132  Salmonella infection
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104022929 (RAF1)
   04012 ErbB signaling pathway
    104022929 (RAF1)
   04370 VEGF signaling pathway
    104022929 (RAF1)
   04371 Apelin signaling pathway
    104022929 (RAF1)
   04068 FoxO signaling pathway
    104022929 (RAF1)
   04150 mTOR signaling pathway
    104022929 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104022929 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    104022929 (RAF1)
   04218 Cellular senescence
    104022929 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104022929 (RAF1)
   04540 Gap junction
    104022929 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104022929 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    104022929 (RAF1)
   04625 C-type lectin receptor signaling pathway
    104022929 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104022929 (RAF1)
   04912 GnRH signaling pathway
    104022929 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    104022929 (RAF1)
   04916 Melanogenesis
    104022929 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104022929 (RAF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104022929 (RAF1)
  09172 Infectious disease: viral
   05164 Influenza A
    104022929 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104022929 (RAF1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104022929 (RAF1)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104022929 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 104022929
NCBI-ProteinID: XP_009474973
LinkDB
Position
Unknown
AA seq 672 aa
MEHIQGAWKTISNGFGLKDSVFDGPNCISPTIVQQFGYQRRASDDGKISDTSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLHTEPKGKKVRLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNPNISDSGVPALPPLTMRRMRESVSRIPVSSQHRYSTPHAFTF
NTSNPSSEGSLSQRQRSTSTPNVHMVSTTMPVDSRIIENNSLNASPSSWCRRFCLRGRDA
IRSHSESASPSALSGSPNNMSPTGWAPPQNPQPKTPVPAQRERAPGSNTQEKNKIRPRGQ
RDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVA
VLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQG
MDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPE
VIRMQDSNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYK
NCPKAMKRLVADCLKKVREERPLFPQILSSIELLQHSLPKINRSASEPSVHRAAHTEDIN
SCTLTSTRLPVF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggagcacattcagggagcttggaagactatcagtaatggttttggactcaaggattca
gtctttgatggcccaaactgtatttcacctactatcgtccagcagtttggttatcaacgc
cgagcatctgatgatggcaaaatatcagatacttccaaaactagtaatactattcgtgtt
ttcttgcccaacaagcagcgcacggtggtaaatgtgcgaaatgggatgaccttacatgac
tgtcttatgaaggcacttaaagtaagaggtctgcagccagaatgctgtgcggtttttcga
cttcatactgaaccaaaaggaaaaaaagtgcgtttggattggaatacagatgctgcctcc
ttgattggagaggaactgcaagtggactttcttgatcatgttccactcactacacacaat
tttgctcggaagacatttctaaagcttgctttctgtgacatctgccagaagttcctgcta
aatgggtttcggtgtcagacatgtggttataaattccacgaacactgcagcactaaagtt
ccaaccatgtgtgtcgactggagcaatatcaggcaactcttattgttcccaaatccaaat
atcagtgacagtggtgtccctgcactacctcccttgacaatgagacggatgcgggagtct
gtctcccggatacctgttagttcccagcacaggtattctacacctcatgccttcacattc
aacacttcaaatccttcctctgagggctccctttcccaaagacagcgatctacatccaca
ccaaatgtccatatggttagcactacaatgcctgtagacagccggataattgagaataac
agcctgaatgcttctcccagttcctggtgcagacgattttgtttgaggggaagagatgca
attcgaagccatagtgaatcagcttcaccctctgctctgtctggaagtcctaacaatatg
agtcccactggctgggctcccccccaaaaccctcagcccaaaaccccagtcccagcccaa
agagagagagcccctggatccaatacacaagaaaaaaacaaaattaggcctcgtggacag
agagattccagttattactgggaaatagaagcaagtgaagtcatgctttctaccagaata
gggtcaggttcttttggaactgtttacaaaggcaaatggcatggggatgtagcagtgaag
atactaaaggttgtagatccaaccccagaacagttccaggctttcagaaatgaagtggct
gtattacggaagactcggcatgttaatattttgctctttatgggatacatgacaaaagat
aatctggccattgttacgcagtggtgtgaaggaagcagtctgtataaacacctgcatgtt
caggagaccaagttccaaatgttccagctcattgatattgctcggcagacagcacaggga
atggactatttacatgcaaagaatataatccacagagacatgaaatccaataatatattt
cttcacgaaggtctcacagtgaaaataggagactttggtctggcaactgtaaaatccagg
tggagtggatctcaacaggtggaacagcccactggttcaatcttgtggatggcaccagaa
gtgatacggatgcaggatagtaacccatttagttttcagtcagatgtctactcctatgga
atagtattatatgaactaatgacaggggagttgccatactcccacataaacaaccgagat
cagattattttcatggttggccgagggtatgcttctccagacctcagtaaattgtacaag
aactgccccaaagcaatgaagaggcttgtagcagactgcttgaagaaagttagggaagaa
cgacctctgtttccacaaatactgtcgtccattgaattgttgcaacattctttacccaaa
atcaaccggagtgcttctgaaccatctgtgcatcgtgccgcccacacagaggacataaat
tcatgcacattaacatccacaagactacccgtgttttag

DBGET integrated database retrieval system