KEGG   Nipponia nippon (crested ibis): 104023113Help
Entry
104023113         CDS       T05756                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni03440  Homologous recombination
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    104023113 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104023113 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104023113 (ATM)
   04210 Apoptosis
    104023113 (ATM)
   04115 p53 signaling pathway
    104023113 (ATM)
   04218 Cellular senescence
    104023113 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104023113 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nni03032]
    104023113 (ATM)
   03400 DNA repair and recombination proteins [BR:nni03400]
    104023113 (ATM)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104023113 (ATM)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   104023113 (ATM)
DNA replication proteins [BR:nni03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     104023113 (ATM)
DNA repair and recombination proteins [BR:nni03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    104023113 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT
Motif
Other DBs
NCBI-GeneID: 104023113
NCBI-ProteinID: XP_009475169
LinkDB All DBs
Position
Unknown
AA seq 3054 aa AA seqDB search
MSLVLHDLLICCRRLENEKAVERRKEIENFKRLLRDSETVLQLDRNSDSKQAKQLNWDAL
FSVLQKSFQKEMKTLQLTKPNASASTQTTRQKKMQEIGSLVKYFIRCANKRGPRLKCQEL
LIYVMEIIRDPTSCAAYGSDCSGILLKDILSVRKYWCEISQQQWSELLILYGQLYLKPSG
KINRVLVARIIHTLTRGYCFQTDGLSSDMLIFFSKAMQCARQERNTAGLDHIVGAINIIC
NKFAVNCRIRICKVGEEILPTVLYIWTQYRPKDSLKESIIELFRLQVRIHHPKGAKTQGK
GAYDSTKWQSILHNLYDLLVNEINLISSRGKYSSSSRNIVVKENLIELMADICHQVFTED
TKVLEIAQPYAISQREPGDGTVPSKRRRIELGWEVIRDNLQRSQKDFDVIPWLQITAQLI
SKYPMSLPNSELPPLLNVLHQLLPQQRRGERTPYVLKCLTEVALCQNQKTDLKSTHKLEL
QRTWAKIWSLTIRSVSFQQIEVESFGLLGAMIQGSLVVTDKELWKIFSGPACKPSSSAVH
CLSLVMSAYSVPENLDIGMEQNNCERNLDSLLKEAIMKWLLSCYLEEEMEECAELPPVLC
SDFPYLTLQKILVSLTMKNSRAAMIFFRNDAKCMQHLQGKEENNFSDVEELYLQTTFDEM
DIFTDFAVNVAAKNVTGSRLAIDQNLREALEYCLLSMSEKLLSSYAPKVVAAEHLVRCVS
LFVGVLGCYCYTGIFKEEDACKSELFQKAKSLIHYAGESISQSKNKLNEDAHINSLRTLI
MQCTKCLCNCTKNSANKMLSNIFLHLLTSKFMNDLVDICKNLMRFTGKPSELGEVDLTGN
DPEESIMEVDNQVSDDLFDDHSVTDISDTNEAGETQNVTGALSPLAEEQLTKQDLLLLEI
LRFLCICVTTVQIQTVSFQASDIRRNLLMLTDGSDFDSAKPLHLHVYLVLLKELPIEEHL
LPAGDVRKLLRPLLAMCSLYRRDQEVCKVILNNLLPIAVGLAQYNTHAEETGYAQGQFLT
VVGSFWHLAQEGKCTAPVRVALLNCMKALLEADPHCKWAILNVINKDLPVSDAFPHFLAD
SHHQVRILAAKLITSLFQDVKQKDSSGMSKPLSLKLQQKAFENAYLQVQEGMRNLVRGDV
SPEDLLDKQCNGKAVLLMLITMVLCCSPVCEKQALFAICQSVKENGLEPHLVKKVLKKVS
DIFGYKSVEDFMTSHLDYLVMEWLKINDSGYSLSAFPYVLLNYTSLEEFYRSCYKVLVPH
LVIRSQFEDVKSLASKIEKDWRQVLADCFPKILVNILPYFACQIEQRDTASKVYDMLKDE
NCLGKQVSQMDNLSHSNLPEIVVELLMTLHEPPDTRVEEGAHLSKYIRELDPAPNPPHFP
SYVIKGTLDYISNCHKSKFKSLVALLSKSPDSFQKILLALCKHASDTNNVYKKHRVLIIY
HLFVSLLLKEIKDGLGGAWAFVLRDVIYTLIHHINSRPVIIREISMRSFSLCCDLLHHVC
HTAVTCCKDALESHLHVIVGTLIPLAVDQPEIQEQVLGLLKYLVIDNKDNENLYQAIKCL
DPFPEYPAFKDLRATQQEIKYSKGPYSLLEEINHFLSVGVCDSLPLTRLEGLYDLRKQLE
QYKDQMKDLLKNFQEKPEDSVVVKLVVSLLQLCKMAVNHTGEKAVLEAVGSCLGEIGPVD
FSTIALQRAENALDSKAMDILEDRKLQWVFIMLTQINIALTDNCIDVRAAAVSCLKNILA
TKSGSEFWEVYKNKADPMLIYLQPFRMSRKKFFVVPANDTEASLETLDDTNLWIPLGESH
ETWIKRLTSSILDSGGVQNDILQLMKPLCEVKTDLCQTLLPYLIHDILLHDSDESWRNLL
SVHIQKFFTACCKFASSSRSTTPPNSDSEQETHNLRSLDKVPRRAMLAVVDYLRRQKRSV
SGTVFDDSFWLDLNYLEVAIAAQSCAAHFTALLYAEIYADKINIDKQQESLTFEEESQRT
AITILNEKSKEETGISLQDLLMDIYRSIGEPDSLYGCGGGRMLQPLARIRTYEHEAVWEK
ALVTYDLEASLSPSTRQAGIIEALQNFGLCHTLSTYLKGLEHENTEWCAELQEIRYQAAW
RNMQWGHISSVKNETGRPGYHESLYDALQSLRDKEFSAFYDSLKDARVNEVEELCKGSLE
SVYSLYPTLCRLQLIGELENIGLLFSRSVTTQQLNDVYLKWQKQSELLKDSDFRFQEPIM
SLRTVILEILLEKEGENTKRECIKDILTKHLVELSRLARTAKNTQLPERAMFQIKQYNPT
GYGVSEWQLEEAQVFWAKKEESLALNILKRMIKKLDADWFQVENDPHLKLMYTECLRLCG
TWLAETCLENPTVIMQKYLEKAVEIAASHSGDSSDELKKGKMKAFLSLARFSDNQYQRIE
NYMKSSEFENKQALLKKAKEEVGLLRERRVQTNRYTVKVQRELELDECAIRALTKDCKRF
LCKAVENYISCLLSGEEHDMWIFRLCSLWLENSGVDGVNEMMKKNAEKIPSYKFLPLMYQ
LAARMGTKMMGGLGFHEVLNNLMSRISLDHPHHTLFIILALANANKDELLTKPDTIRRNK
LIKNAPKEISQLDVDRMEAASNIINIVRKRRARMVRDVEALCDAYITLANVDATPWKSER
KGITIPADQPIIKLKNLEDVVVPTMEIKVDPTGQYENLVTIRSFKPEFRLAGGVNLPKII
DCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQQNTETRKRKLTIRRYKVVPLSQ
RSGVLEWCSGTTPIGEFLVNVEEGAHKRYRPNDYSGYQCQKMMMDAQRKHSEEKCNIFME
VCENFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEQT
AELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMAVMRNSQ
EALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADMSATLNTDPQTCKRKASSDDQSF
NKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSQLFPGWKAWV
NT seq 9165 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgtattacatgatctgctcatttgttgtcgacgccttgaaaatgagaaggct
gtggagcgaaggaaggaaattgaaaatttcaagcgacttctccgtgattctgaaacagtt
ctccagctggaccggaattctgattctaaacaagcaaagcagctcaactgggatgctcta
tttagtgtcctgcagaaatctttccagaaagaaatgaaaaccctccagctgacaaaacca
aatgcatctgcttcaactcaaactaccagacaaaaaaagatgcaagaaattggaagtttg
gtcaagtatttcatcagatgtgctaataaaagaggacccagactgaaatgtcaggaactt
ctgatttatgtcatggaaattataagagatccaacaagttgtgctgcttatggatctgac
tgtagtggtatactcctaaaagatatcctctcagtaaggaaatactggtgtgagatatcc
cagcagcagtggtcagaattgctgatcctgtatggccaattatacctcaaaccttctggc
aagattaatagagtcttggtggcaaggataattcacacacttacgagggggtactgcttc
caaactgatgggttgagttctgatatgcttatcttcttttcaaaagcaatgcagtgtgca
aggcaggagagaaatactgcaggcctggatcatattgttggagcaattaacatcatctgc
aataagtttgctgtcaactgtcgcatacgaatttgtaaagtaggagaagaaattttgcct
acagtgctttatatatggactcagtatagaccaaaggattccctgaaggagtcaataatt
gagttatttcgtctccaagttcgtattcatcatccaaagggtgcaaaaacgcagggaaaa
ggtgcatatgactcgacaaaatggcaaagtatcttacataatctatatgatctgctggtg
aatgaaataaatctcatcagtagcagaggaaagtattcttcaagctcacgtaatattgtt
gtaaaggaaaatttgattgagttgatggctgatatttgtcatcaggtttttacagaggat
accaaagttctggaaattgcccagccttatgccatttcacaaagagagcccggtgatgga
acagtaccaagcaagcgcaggaggattgaactaggctgggaggtaattcgagacaacctg
caaagatcccagaaggactttgatgtcataccttggttacagattacagctcaattaata
tcaaagtatcccatgagtcttcctaacagtgagctacctcccttactcaatgtacttcac
cagttactgcctcagcagcgccgaggagaaaggaccccatacgtgctgaagtgtctcaca
gaggtagctttgtgtcaaaaccagaaaactgatttgaaaagcacccacaagttggagctc
caaagaacctgggcaaagatttggtcccttaccattcgtagcgtcagtttccagcaaatt
gaagtggagagctttgggctacttggagctatgattcaaggaagccttgttgtaacagat
aaagaactctggaagatattttcaggacctgcatgcaagccttcaagttctgctgtacat
tgtttatcattagtgatgtctgcctattcagtgccagaaaatttggacataggaatggaa
cagaataattgtgaaagaaatcttgattctctgctaaaggaggcaataatgaaatggcta
ctgtcctgctatttggaggaagaaatggaagaatgtgcagagttgccccctgtgctctgc
agtgattttccttatcttacgttacaaaaaattcttgtgagccttacaatgaagaactct
agagctgccatgatttttttccgaaatgatgctaaatgtatgcaacacttgcaagggaaa
gaagaaaacaatttttctgatgttgaagagctgtatctgcagacaaccttcgatgaaatg
gatattttcactgactttgcagtaaatgttgcagctaaaaacgtgactggctcaagactt
gccatcgaccaaaatcttagggaagcactggagtactgtcttttatcaatgtcagaaaag
cttttaagcagctatgctcctaaggttgttgctgcagaacaccttgtccgatgtgtcagt
ctcttcgttggtgttcttggttgctattgctacactggcatatttaaagaagaggacgcc
tgcaaatcagagttgttccagaaggctaagtctctcattcattatgccggggaaagcatt
tctcagtctaaaaacaaactaaatgaagatgcccacatcaactcactgaggactctaata
atgcagtgtacaaaatgtttatgcaattgtaccaagaacagtgctaataagatgctgtct
aatatattcctgcatttgttaacatcaaaatttatgaatgatcttgtagatatttgcaaa
aatctgatgagatttactggaaaaccaagtgaactgggagaagtggatctaacagggaat
gatcctgaggagagtataatggaagtagataaccaggtatctgatgatctatttgatgat
cattccgtgactgacatcagtgatacaaatgaagctggtgagacgcaaaatgtaaccggt
gctttgagtccgttagccgaagaacagttgacaaagcaggatttacttctccttgaaatt
ctgaggttcttatgtatttgtgtaacaacagtccaaattcagacagtgagcttccaagcc
tctgatatacggaggaatctgttaatgcttactgatggcagtgactttgacagtgctaag
ccactgcatctgcacgtgtacttggtccttttgaaggagctccctattgaagaacacctg
ttgcctgcaggcgatgttcgtaagcttcttaggcctcttcttgccatgtgttctttgtac
cgtcgagatcaagaagtttgtaaagtaattttaaataatttgcttcctatagcagtaggg
ttggcccagtacaacacacatgccgaagagacagggtatgcccaaggacaatttctgaca
gttgttggatctttttggcatttagctcaagaagggaaatgcacagcaccagtcagagtg
gcccttttaaactgcatgaaagccctgcttgaggctgatcctcattgcaagtgggcgatc
cttaatgtgataaataaagatctacctgtgagtgacgctttcccacattttctcgcagat
agtcaccatcaagttcgcattcttgctgcaaagttgattaccagtttgtttcaggatgtg
aaacagaaagattcttctggaatgtcaaaacctctttccttgaagctccaacaaaaggct
tttgagaatgcatatctccaagttcaggaaggaatgagaaatctggtcaggggtgatgta
agtcctgaagatcttttggacaaacagtgtaatggaaaagctgttttgctgatgcttata
accatggttctgtgctgcagtcctgtctgtgaaaagcaagctttgtttgctatttgccag
tctgtgaaagagaatgggttagaacctcaccttgtgaaaaaggttttgaaaaaagtatct
gacattttcggctataaaagtgtagaagacttcatgacatcacatttagactatttggtg
atggagtggctgaaaataaatgacagtggatatagcctgtctgcttttccttatgttctc
ctgaactatactagccttgaggaattctacaggtcttgttataaagttttggttccacac
ctggtgattagaagtcaatttgaagatgtgaaatcacttgccagcaagattgaaaaagac
tggaggcaggttctagcagactgttttccaaagatacttgtgaatatcctcccgtatttt
gcctgtcaaatagagcaaagagatacggcttccaaagtctacgacatgcttaaggatgaa
aactgcttaggaaaacaggtatctcaaatggacaatttatctcatagtaacttaccagag
attgtggttgaactgttgatgaccttacatgaaccacctgataccagggtagaagaagga
gctcatttaagtaaatatataagggaactggatcctgctcctaatcctcctcattttcca
tcttatgtgattaagggaaccttggactatattagcaactgtcataaaagcaaatttaaa
agtcttgtagcacttctttctaaaagccctgattcattccagaaaatccttctagccctt
tgtaagcatgcatcagatacaaacaacgtttacaaaaaacacagagttcttataatttat
cacttgtttgttagtctgttacttaaagagataaaagatggtttaggaggagcatgggct
tttgtactccgagacgtaatttacaccctgattcaccacatcaatagcagacctgttatt
atcagagagatatccatgcgcagcttttcactctgttgtgatcttcttcatcatgtttgc
cacacagcggttacgtgttgcaaagatgctctagagagccaccttcatgttattgtagga
accctaatacctcttgctgtggaccagcctgagattcaggaacaggtcctaggcttgttg
aagtatctggtgatagataataaggataatgaaaatctgtaccaagcaatcaaatgctta
gatccttttcctgaatatcctgcttttaaagatttacgagcaactcaacaggagataaaa
tacagtaaaggaccatattctcttttggaggaaattaatcactttctctcagttggtgtt
tgtgattcactgcccttaacacgacttgaaggactgtatgatttacgcaaacaattggaa
caatataaagatcagatgaaggatctcctgaaaaatttccaggaaaagccagaagattct
gtagtagtgaaattggtggtgagcttactgcagctgtgcaagatggcagttaaccatacg
ggcgaaaaagcagtgctggaggctgttggaagttgcttgggagaaataggtcccgtggat
ttctccaccatagctcttcagcgtgctgaaaatgcactggattctaaagcaatggacata
cttgaagatagaaaacttcagtgggtcttcataatgttaactcaaataaatattgcttta
acagataattgtattgatgttagagccgctgctgtttcctgtttgaaaaatatattagcc
accaagtctggcagtgaattttgggaagtttataaaaacaaagctgatcccatgttaatc
tatctacagcctttcagaatgtctaggaaaaagttttttgtagtacctgctaatgataca
gaggcttctttagaaactttggatgacacaaacctctggattcctctgggagaaagtcat
gagacctggatcaagcgcctaactagttcaatactggacagcggaggtgtgcaaaatgac
attctccagttaatgaagccgctatgtgaggtgaaaacagacttgtgtcaaactttgctt
ccatacctgattcatgatatccttcttcatgactcagatgaatcttggagaaatcttttg
tcagttcatatccagaagttttttacagcctgttgcaaattcgcctcctctagtaggtct
actacacctccaaattccgattcagagcaagaaacccataatttaagaagtttggataaa
gtacctcgacgggccatgcttgctgttgttgattacttaagaagacaaaagagatctgtt
tcaggtacagtttttgatgacagcttctggctagatctgaattatcttgaggttgctata
gcagcacagtcttgtgctgctcacttcacagccttgctctatgcagagatctacgcagac
aagataaatatagacaaacagcaagaaagtttgacgtttgaagaagaaagtcaaagaaca
gctattactattttgaatgaaaaaagtaaagaagaaaccggcataagtttacaggacctt
ctcatggacatatatagaagcattggagaacctgacagtctctatggctgcggtggagga
agaatgttacagccattagcacggataaggacgtatgagcatgaagcagtatgggagaaa
gcccttgtaacatatgaccttgaggcaagcctctctccatctactcgccaggcaggaata
atagaggctttgcagaattttgggctttgccatactctttccacgtatttaaaaggactg
gaacatgaaaacactgagtggtgtgcggaactgcaggaaatacgctaccaggcagcatgg
agaaatatgcagtggggccacatctcttctgtcaaaaatgaaacaggaagaccagggtac
catgaatcattgtatgatgctcttcagtctttacgagataaggaattctctgctttctat
gacagtcttaaagatgccagagtgaatgaagtagaagagctgtgcaaaggcagtcttgag
tctgtttattcattatatccaactctttgcagactacagctaattggagagttggaaaat
ataggtctgctgttctccagatctgttactactcaacaactgaatgatgtttatttgaaa
tggcagaaacagtccgagcttctcaaggacagtgacttccgtttccaggaacctatcatg
tctctgcgcactgtaattttggagatcttgcttgagaaagagggtgaaaataccaaaaga
gaatgtattaaagacatcctgaccaaacatctagtggagctctctagattggcaagaact
gctaaaaatacacagcttccagaaagagctatgtttcagatcaagcaatacaatccaaca
ggatatggagtttctgaatggcaactagaagaagctcaggttttctgggctaaaaaggaa
gagagtcttgcactgaatattcttaaaaggatgataaaaaaattagatgcagattggttt
caggttgagaatgatcctcatctgaaattgatgtatacagagtgtctgaggctgtgtgga
acctggttagcagaaacgtgcttggaaaaccctacagtcatcatgcagaaatacttagaa
aaggctgtagaaattgctgcaagccacagtggagacagcagtgatgagctgaagaaagga
aagatgaaggctttcctgtctttggctcgtttctcagataatcagtaccagcgaattgag
aattacatgaaatcctcagagtttgaaaataagcaggcattactgaagaaggccaaggag
gaggttggcctcctaagggagcgcagagttcagacaaacagatatacagtgaaggttcag
cgagaacttgaactggatgaatgtgccatacgtgccctaactaaggattgtaaacgtttc
ttgtgtaaagcagtggagaactacatcagctgtttactaagtggagaagaacatgatatg
tggatcttccgactctgttccctgtggcttgaaaattctggagttgatggagtcaatgaa
atgatgaagaaaaatgcagagaagatcccttcatacaagtttttgcctctgatgtaccag
ctggctgctcggatgggaactaagatgatgggtggtttaggatttcatgaagttctgaat
aacctaatgtctagaatttcactggatcatccacatcatactttgtttataatattagct
ttggcaaatgctaacaaagatgaactcctcacaaaaccagacacaataagaagaaataag
ttaattaaaaatgcaccgaaagaaatctcccagcttgatgtggacagaatggaggctgct
agcaatataatcaatattgtaagaaaaaggagagctcgtatggttagagacgttgaagca
ctttgtgatgcttacatcacgttagcaaatgtagatgctactccatggaaatctgaaaga
aaaggaataactattccagctgaccagccaattattaaactgaagaacttggaggatgtt
gttgttcctaccatggaaattaaggtggatcccacaggacaatatgaaaatttggtgaca
ataaggtcttttaagccagaatttcggttagcaggaggcgtgaatctgcctaaaataata
gattgtgtaggatcagatggtaaagaaaggaggcagctggttaaggggcgtgatgacctg
agacaagatgctgttatgcaacaggttttccagatgtgcaatacattgctccagcagaac
acggaaacacgaaagagaaaattaactatccgaagatacaaggtggttcccctttctcag
agaagtggtgttcttgagtggtgctcgggaacaacccccattggggagtttctggtgaat
gtcgaagagggagctcacaagagatacaggccaaatgattactccggttatcagtgtcag
aaaatgatgatggatgcacagaggaaacattctgaagagaaatgcaacatcttcatggaa
gtctgtgagaactttcagcctgtgtttcgttatttctgcatggaaaaattcctggatcca
gctgtgtggtttgaaaaacgattggcgtacactcgcagtgtggctacatcttctatagtt
ggctacattgttggacttggagacagacatgttcagaatatcttgatagatgaacaaaca
gcagaactagtgcatatagatctgggggttgcttttgagcaaggcaaaatccttcccaca
ccagagaccgttccatttagattaaccagggacattgtggacggaatgggtattactggc
gttgaaggagtcttcagaagatgctgtgagaaaacaatggctgttatgagaaattctcaa
gaagctttgctgactattgtagaggtgctgctctacgatcctcttttcgactggaccatg
aaccccttgaaagctttgtatttgcagcagagaccggaggatgaggctgacatgagcgct
acactcaatactgatccacaaacatgtaaaagaaaagccagcagtgatgaccagagtttt
aacaaagtggctgagcgagttctgatgagacttcaggagaagctgaaaggtgttgaggag
ggaacagtgctcagtgtgggagggcaggtgaacctcctcatacagcaggccatggaccct
aagaatctgagccagctcttccctggatggaaagcctgggtctga

DBGET integrated database retrieval system