KEGG   Nipponia nippon (crested ibis): 104023516Help
Entry
104023516         CDS       T05756                                 

Gene name
SLC16A2
Definition
(RefSeq) monocarboxylate transporter 8
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nni02000]
    104023516 (SLC16A2)
Transporters [BR:nni02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   104023516 (SLC16A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    104023516 (SLC16A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 104023516
NCBI-ProteinID: XP_009475625
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MSSRSRLGIARQGQGCHLTWYNLCVSHQLSCNEKSPLNVGRGGAWVGSLAMGMIFFCSPI
VSIFTDRIGCRTTAASGAAIAFIGLLSSSFTKSLEVRYFTYGILFGCGSSFAFQPSLVIL
GHYFKRRLGLANGIVAGGSCLISVPLPFFLKMVGKAIGLAHTFQVLSALMLIQIFLSLTY
RPILPPSCDSQHDGQDKLGSRSMRQQCWAQTRKYFNLRVFRRKTYRIWAFGIATAVLGYL
VPYMNLVKYVEKRFQETKKDWILLVCLGAMSGLGRLVSGRIGDCIPGLKKIYLQVASFML
LGLLCMMIPQCRGFEGVIVICLFLGLCDGFFTTIMAPIAFELVGPMQASQAIGYLMGLMA
VPMTAGTPIAGYLNDYFENYDAAFYFAGVPPIIGALVLSVVPLVHQRMLKKQRLDPGKDK
MLVSEAVVNGELLPGCPASEAHM
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagctcacggtcccgcctgggcatcgcccggcagggccagggatgtcatctaacctgg
tacaacctgtgtgtctcccaccagctcagctgcaatgagaaatccccgctgaacgtgggg
cgagggggagcatgggtcggctctttggccatgggcatgatttttttctgctctcccatc
gtcagcatcttcaccgaccggatcggctgcaggaccacagcagcctccggagctgccatc
gccttcatcggactcctctccagctccttcaccaagtctctggaagttcgttatttcaca
tatgggatcctctttggctgcggcagctccttcgccttccagccctcactggtcatcctt
ggtcactacttcaagcgccgccttggtttggccaatggcatcgtggccggcggcagctgc
ctcatctccgtgccgctccccttcttcctgaagatggtcgggaaggccattgggctggcg
catactttccaagtactcagtgccttaatgctcatccagatattcttgtccttgacctat
cggcccatcttgccgccttcttgtgactctcaacacgatgggcaggacaagctgggcagc
cggagcatgcggcagcagtgctgggcccagacgcgcaaatatttcaacttgagggttttc
cggagaaagacctatcggatttgggcctttgggatcgctactgctgtcctgggatatctc
gtaccttacatgaacctggtaaaatacgtggagaagcgatttcaggaaaccaaaaaggac
tggatcctcttggtttgccttggagccatgtcagggctggggcgcttggtttcaggccgc
attggcgactgcattcctgggctgaagaagatttacctgcaggttgcatccttcatgctg
ttgggcctcctgtgcatgatgatcccccagtgccgagggttcgaaggcgtcattgtcatc
tgcctcttcctcggcctttgcgatggcttcttcaccaccatcatggcccccatcgccttc
gagctggtggggcccatgcaggcatcccaggccatagggtacctcatggggctgatggct
gtgcccatgaccgcgggtacaccgatagcaggatacctcaatgattattttgagaattac
gacgcggccttttattttgctggagtccctcccatcatcggcgccttggtgctctccgtc
gtcccgctggtccatcagaggatgctgaagaagcagcgcctggatcccggcaaagacaag
atgctggtctcggaggcggtggtgaacggggagctgctgccgggctgtcctgcctccgaa
gcacacatgtaa

DBGET integrated database retrieval system