KEGG   Nocardia nova: NONO_c00380Help
Entry
NONO_c00380       CDS       T03032                                 

Gene name
pknB
Definition
(GenBank) serine/threonine protein kinase PknB
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nno  Nocardia nova
Brite
KEGG Orthology (KO) [BR:nno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nno01001]
    NONO_c00380 (pknB)
Enzymes [BR:nno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NONO_c00380 (pknB)
Protein kinases [BR:nno01001]
 Serine/threonine kinases: Other
  Bacterial family
   NONO_c00380 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo ABC1 Seadorna_VP7 RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AHH14859
UniProt: W5T6W4
LinkDB All DBs
Position
complement(43686..45578)
Genome map
AA seq 630 aa AA seqDB search
MTTPKNLSSRYELGEIIGFGGMSEVHKARDLRLGRDVAIKVLRADLARDPTFYLRFKREA
QNAAALNHPAIVAVYDTGEAEVDGGPLPYIVMEYVDGETLRDIVRGKGPLPPRRAMEIIA
DVCAALDFSHKNGIVHRDMKPANIMINRQGAVKVMDFGIARAIADSSNPMTQTAAVIGTA
QYLSPEQARGEQVDARSDVYSVGCVLYEILTGQPPFTGDSPVAVAYQHVREDPKLPSLVH
PGVPRELDSVILKAMAKNPANRYQSAAEMRADLIRVLGGQKPHAPTVMTEEDRTTFLSSN
EPEPRSYRRVDGDGDGDPEETPSRRRLWIGVGAAVAVAVLFALFWVLLGPGSRPDQVAIP
DLSSKPAQQAQDQLQGLGFKVTIQPKPDSKIASGNVVSTQPLGGARVDKGSTVTVLVSSG
PQLVPVPDLTHRTQQQAQLDLNDAGLLLDGNVQRDWSSPEDKDKVVRQEPQPNSKADSGS
AVKVWLGKGPEQVRVPIVVGQQIDVAEPNLSTSAGFKVVIQKVASSRPAGEVISTDPAGG
STADRGSTVTVQVSSDQIQMPNLYGLTPSEAISKLQAAGWQGTAAQISQTTQGTLVASNI
GRIIDQNPGTGSTVSRTGTISIVTGALAPP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccccgaagaatctgtcttctcgctacgagcttggcgagatcatcggattcggt
ggtatgtcggaggtccacaaggctcgtgacctgcggttgggtcgtgatgtggcgatcaag
gtgctgcgcgccgatctcgcccgcgaccccacgttctatctgcggttcaagcgggaggcg
cagaatgccgcggcactgaaccatccggcgatcgtggcggtgtacgacaccggcgaggcc
gaggtggacggtgggccgctgccgtacatcgtgatggagtacgtcgacggcgagacgctg
cgcgatatcgtgcgcggcaagggtccgctgccgccgcgccgggcgatggagatcatcgcc
gatgtctgtgccgcactggatttcagccacaagaacggcatcgtgcaccgcgatatgaag
ccggccaacatcatgatcaaccgccagggcgcggtgaaggtgatggacttcggcatcgcg
cgcgccatcgcggacagctccaatccgatgacccagaccgcggcggtcatcggcaccgcg
cagtatctgtcaccggaacaggcccgcggcgaacaggtcgacgcccgctccgatgtgtat
tcggtcggctgtgtgctgtacgaaatcctcaccgggcagccgcctttcaccggcgattcg
cccgtcgcggtggcgtatcagcacgtccgcgaggatccgaagctgccgtcgctggtgcat
cccggcgttccgcgcgagctcgattcggtgatcctcaaggcgatggccaagaatccggcc
aaccggtaccagagcgcggcggagatgcgcgccgacctgatccgggtgctgggcggccag
aaaccgcatgcgccgacggtgatgaccgaagaggaccgcaccaccttcctcagcagtaac
gaacccgagccacgcagctaccgcagggtcgacggtgacggcgacggcgatcccgaggaa
acgccgtcccggcggcggctgtggataggtgtgggcgcggcggtcgcggtcgcggtgctg
ttcgcgctgttctgggtactgctcggtcccggcagccgacccgatcaggtcgccatcccc
gatttgtccagcaaacctgcccagcaggcacaggaccagttgcaggggctcggcttcaag
gtcaccatccagccgaaacccgactccaagatcgccagcggaaatgtcgtctccacccag
ccgctcggcggcgcccgggtcgacaagggttccaccgtcacggttctggtatccagtggt
ccgcagctggttccggtccccgacctcacccacaggacgcagcagcaggcgcaactggat
ctgaacgacgccggtctgctgctggacggaaacgtccagcgcgactggtccagtccggag
gacaaggacaaggtggtccgccaggaaccacagccgaattcgaaggccgacagcggcagc
gcggtcaaggtctggctgggtaaagggccggagcaggtccgggttcccatcgtcgtcggt
cagcagatcgatgtcgcggagccgaacctgtccaccagcgcgggtttcaaggtcgtgatc
cagaaggtcgcgtcctcgcgtccggcgggcgaggtgatctccacggatccggcgggcggc
tcgacggccgatcgcggttccacggtcaccgtccaggtctccagcgaccagatccaaatg
ccgaatctctacggcctcaccccgtccgaggcgatcagcaaactccaggccgcgggctgg
cagggcacggccgcccagatctcccagaccacacagggcactctcgtggcgagcaatatc
ggccgcatcatcgaccagaatccgggtacgggatcgacggtttcgcgcacgggcaccata
tccatcgtgacgggcgctctcgccccaccgtga

DBGET integrated database retrieval system