KEGG   Nocardia nova: NONO_c10100Help
Entry
NONO_c10100       CDS       T03032                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nno  Nocardia nova
Pathway
nno00473  D-Alanine metabolism
nno01100  Metabolic pathways
nno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NONO_c10100 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NONO_c10100 (alr)
Enzymes [BR:nno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NONO_c10100 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:nno01011]
 Precursor biosynthesis
  Racemase
   NONO_c10100 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHH15817
UniProt: W5T9B3
LinkDB All DBs
Position
1152442..1153584
Genome map
AA seq 380 aa AA seqDB search
MTSADPQVETVVDLDAIAHNVRVLRAHAGDAAVMVVVKADAYNHGAVQVGRAALAAGAAE
LGVTTIAEALELRAAGITAPILSWLNNADADYAAAIAADIEIGVSSAGHLRAVERAARAS
GTTATVTLKIDTGLNRNGVSSQEYPQVLALLRELVDEGVVRLRAMFSHLAHADEPNHPVI
DVQRDRFTAAIATAKEFGLEPELVHLANSAATLTRPDLAFDMVRPGIAVYGLSPTPEISD
FDLRPAMTFRARVALVKRVAQGEGVSYGHEWIAPHDTTVALIPAGYADGVPRGLGGRIAV
RIGEADYPNIGRVCMDQLVVDLGENPRGVAEGDRAVLFGGAPGDPHAQQWADLLHTIHYE
IVCSPRGRVVRRYTGQAGVV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgactagcgctgatccgcaggtggagaccgtcgtcgatctggatgccatcgcacacaat
gtgcgggtgctgcgcgcgcacgccggtgacgccgcggtcatggtggtggtcaaggccgat
gcctacaaccacggcgcggtccaggtcgggcgggccgcgctggcggccggtgccgccgaa
ctgggggtgaccacgatcgccgaggccttggagctgcgggcggccggaatcaccgcgccg
atcctgagctggctcaacaacgccgacgccgactacgccgccgcgatcgccgccgatatc
gagatcggggtgtcctcggccggtcatctgcgtgcggtggagcgggccgcgcgggcgagc
ggaaccacggccaccgtcaccctgaagatcgacaccgggctcaatcgcaacggcgtctcc
tcgcaggagtacccgcaggtgctggcgctgctgcgggagctggtcgacgagggcgtggtg
cggttgcgggcgatgttctcccatctcgcgcacgccgacgagccgaaccatccggtcatc
gatgtgcagcgcgaccgcttcacggcggccatcgcgaccgcgaaggaattcggcctggaa
cccgaactggtgcatctggccaattccgcggccaccctcacccggcccgatctggccttc
gacatggtccgccccggtatcgcggtctacggcctgagccccacccccgagatctcggat
ttcgacctgcgcccggcgatgaccttccgcgctcgcgtcgccctggtgaagcgggtggca
cagggagagggggtgtcctacgggcacgaatggatcgcgccgcacgacaccaccgtcgcc
ctgattccggcgggttatgccgacggtgtgccgcgcggtctgggcgggcgcatcgcggtg
cggatcggcgaggcggactatccgaatatcggccgggtctgcatggatcaactggtcgtg
gatctgggcgagaacccgcgcggggtggccgagggggaccgcgccgtgctgttcggcggc
gcgcccggcgacccgcacgcccagcagtgggcggatctcctgcacaccatccactatgag
atcgtgtgttccccgcgcggccgtgtcgtgcgacgctataccggacaggcaggggtggtg
tga

DBGET integrated database retrieval system