KEGG   Nocardia nova: NONO_c10640Help
Entry
NONO_c10640       CDS       T03032                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nno  Nocardia nova
Pathway
nno00020  Citrate cycle (TCA cycle)
nno00480  Glutathione metabolism
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
nno01120  Microbial metabolism in diverse environments
nno01130  Biosynthesis of antibiotics
nno01200  Carbon metabolism
nno01210  2-Oxocarboxylic acid metabolism
nno01230  Biosynthesis of amino acids
Module
nno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nno_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NONO_c10640 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NONO_c10640 (icd)
Enzymes [BR:nno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NONO_c10640 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AHH15871
UniProt: W5TF70
LinkDB All DBs
Position
1206231..1207448
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDKTDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFNLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVHQAGTVTIQFTPEDGSEPIVHEVVKMPEDGGVVM
GMYNFKKSIEDFARASLNYGLQQNYPVYMSTKNTILKAYDGMFKDTFQEIFETEFKQEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWSRGLAHRGKLDNTPEVIGFAQTLE
DVVIKTVESGQMTKDLALLVGGNQGYLTTEEFLGVLDANLARELK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaagggaccgtcgtcgaactcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctgatccatccgtacctcgatgtgaatctcgag
tactacgacctgggcatcgaataccgcgacaagaccgatgaccaggtgaccgtcgacgcg
gccaacgccatcaagaaacacggcgtgggcgtcaagtgcgccaccatcacccccgacgag
gcgcgggtcgaggagttcaatctcaagaagatgtggcgttcgccgaacggcacgattcgt
aacatcctcggcggcaccatcttccgcgcgccgatcatcatctccaacgttccgcgtctg
gttcccggctggaccaagccgatcatcatcggccgtcacgccttcggtgaccagtaccgc
gccacggacttcaaggtgcaccaggcgggcaccgtcacgatccagttcaccccggaggac
ggctccgagccgatcgtccacgaagtggtgaagatgcccgaggacggcggcgtcgtcatg
ggcatgtacaacttcaagaagtccatcgaggacttcgcgcgggcctcgctgaactacggc
ctgcagcagaactacccggtctacatgtcgaccaagaacaccatcctgaaggcctacgac
ggcatgttcaaggatacgttccaggagatcttcgagaccgagttcaagcaggagttcgat
gccgccgggctcacctacgagcaccgtctgatcgacgacatggtcgcctccgccctgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgatgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctcggtgctgctcaccccggacggc
cgcacctgtgaggccgaggccgcgcacggcaccgtgacccgccacttccgccagcaccag
cagggcaagcccacctccacgaacccgatcgcctcgatcttcgcgtggagccgtggcctc
gcccaccgcggcaagctggacaacacccccgaggtcatcggcttcgcgcagaccctcgag
gatgtcgtcatcaagaccgtcgagagcggccagatgaccaaggatctggcgctgctggtc
ggcggcaaccagggctatctgaccaccgaggaattcctcggcgttctcgatgccaacctg
gcgcgcgaactgaagtaa

DBGET integrated database retrieval system