KEGG   Nocardia nova: NONO_c11360Help
Entry
NONO_c11360       CDS       T03032                                 

Gene name
glpD1
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nno  Nocardia nova
Pathway
nno00564  Glycerophospholipid metabolism
nno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NONO_c11360 (glpD1)
Enzymes [BR:nno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NONO_c11360 (glpD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA Pyr_redox Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHH15943
UniProt: W5TAE6
LinkDB All DBs
Position
1278314..1280062
Genome map
AA seq 582 aa AA seqDB search
MNEKSHGQHTGELGPEQRAATWESLGANHFDVIVIGGGVVGAGIALDAATRGLEVALVEA
RDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELSLTTLAPHLVKPLRFLYPLTH
RGWERPYVASGIMLYDSLGGAKSVPGQHHVTRSGALRLAPGVRRDALIGGVTYYDTVVDD
ARHTMTVARTAAHYGAVIRTSTQVVDFLREADRVVGVKVRDSEDGRTTEVRGHVVINATG
VWTDELQALSHVRGRFHVRASKGVHIVVPRDRITSDAALILRTQTSVLFVIPWGSNHWII
GTTDTDWNLDLAHPAATKADIDYLLDRINEVLVTPLTHDDIQGVYAGLRPLLAGESDETS
KLSREHAVARIAPGLVAIAGGKYTTYRVMAYDAVDAAARDIPQRVSPTITDKVPLLGADG
YFALLNQTPQLAQTYGVHPYRIEHLLNRYGALVTDVLDLAEGKSELLQPITDAPSYLRVE
AVYAAVAEGALHLDDILARRTRISIEYSHRGTECAEEVAGLVAPVLGWDAEQIRREVSTY
TARVEAEVRSQTQPDDVSADALRAAAPEPRPEILEPVPLPQN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatcacacggtcagcacaccggcgaactgggtcccgaacagcgggcggcg
acctgggagagtctgggcgccaaccacttcgacgtcatcgtgatcggtggcggggtggtc
ggcgcgggtatcgccctcgatgccgccacccgcggcctggaggtggccctggtggaggcg
cgtgatctggcctcgggcacctcgagccgttcgtcgaagatgttccacggcggcctgcgg
tacctggaacaactggaattcggcctggtccgggaggcgctgcgggagcgggagctgagt
ctgacgacgctcgcaccgcatctggtgaagccgctgcgcttcctgtatccgctcacccac
cgcgggtgggagcgcccgtacgtggcctcggggatcatgctctacgactccctgggcggt
gcgaaatccgttccgggacagcatcatgtgactcgttccggggcgctgcggctggcgccc
ggggtgcgccgcgacgccctgatcggcggtgtcacctactacgacaccgtggtcgacgac
gcccgccacaccatgacggtggcccgcactgccgcgcactacggcgcggtgatccgcacc
tcgacccaggtcgtggacttcctgcgggaggccgaccgggtggtcggggtcaaggtgcgc
gacagcgaggacggccgcaccaccgaggttcgcggtcatgtggtgatcaacgcgaccggg
gtgtggaccgacgaactgcaggcgttgtcgcatgtgcgcggccgattccatgtgcgcgcc
tccaagggtgtgcacatcgtggtgccgcgcgaccgcatcaccagcgacgcggcgctcatc
ctgcgcacgcagacctcggtgctgttcgtgatcccgtggggcagcaaccattggatcatc
ggcaccaccgacaccgactggaatctggacctggcgcatccggccgccaccaaggccgat
atcgactatctgctcgaccggatcaacgaggtcctggtcaccccgctcacccacgacgac
atccagggcgtgtacgcgggactgcgcccgctgctggcgggggagagcgacgagacctcg
aaactgtcgcgtgagcacgcggtcgcgcggatcgctccgggactggtcgccatcgccggt
ggcaagtacacgacctaccgcgtgatggcctacgacgcggtcgacgcggcggctcgcgat
atcccgcaacgggtttcgcccacgatcaccgacaaggtgccgctgctgggcgccgacggc
tacttcgccctgctcaatcagaccccgcagctggcgcagacctacggtgtgcacccctac
cgcatcgagcatctgctcaaccggtacggcgcgctggtcaccgatgtcctcgatctggcc
gagggcaaatccgaactgctgcaaccgatcaccgacgcgcccagttatctgcgggtggag
gcggtctacgcggccgtggccgagggcgcgctgcatctcgacgacatcctcgcccgccgc
acccgcatctccatcgagtactcccatcgcggcaccgaatgcgccgaggaggtggcgggg
ctggtggcgccggtgctgggctgggacgccgagcagatccggcgcgaggtgagcacctac
acggcccgggtcgaggccgaggtgcgatcccagacgcagcccgacgacgtgtcggccgac
gcgctgcgggcggcggcgccggaaccgcggccggagatcctcgaaccggttccgctgccg
cagaattag

DBGET integrated database retrieval system