KEGG   Nocardia nova: NONO_c27020Help
Entry
NONO_c27020       CDS       T03032                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
nno  Nocardia nova
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHH17494
UniProt: W5TEB7
LinkDB All DBs
Position
2951491..2952951
Genome map
AA seq 486 aa AA seqDB search
MVWQGEYDRLFIGGRWVTPSTDEVIEVISPYTEKPIARVPAGANADVDVAVAAARTAFDR
GPWPRMPLADRIEVMGRLSAQMHAAETSMAELVTAEMGCPITQSHGIQAARPRSIVDAMI
ELARDHPFDEIREAPSGRARVTREPVGVLAAIVPWNAPHLVTMMKLAPALLAGCTVVLKP
SPETPLDAYLLAELLSRAGLPDGVVNIVPAHREPSEYLVTHPGVDMVSFTGSTGAGRRIG
SLCGGLVRRVALELGGKSAAVVLDDADLESTVSALRTGAFRNTGQVCSSKTRVVVSRRRA
AEFADALRDATEGMPVGDPSDPRTEFGPLVSSRQREAVEGYIRSGRAEGATVVLGGGRPH
GLDTGWFVEPTIFAGVRPDMRIAQEEIFGPVLSILEYDTEDEAIEIANDSSYGLNGAIFT
ADPQHAVALAERIRTGTVEINGNPVGLAAPVGGVKDSGVGRELGPEGFDEFIEFKSIGLP
RDLALG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggcaaggtgaatacgaccggttgttcatcggcggccggtgggtgacgccgtcg
accgacgaggtcatcgaggtgatctccccgtacaccgagaaaccgatcgcacgggtaccg
gccggtgcaaatgccgatgtcgacgtcgccgtggccgccgcgcggacggcattcgaccgc
gggccgtggccgcggatgccgctagccgatcgcatcgaggtgatgggcaggctgagcgcg
cagatgcacgccgccgaaacctccatggccgaactcgtgaccgccgaaatgggttgcccc
atcacgcaatcgcacggaatccaggcggcgcggccgcgttcgatcgtggacgcgatgatc
gagctggcgcgggatcatccgttcgacgagatccgcgaggcgccttccgggcgcgcacgg
gtcacccgcgagccggtcggcgtactggcggcgatcgtgccgtggaacgcaccgcatctg
gtgacgatgatgaaactggccccggcgctgctggcgggatgcaccgtcgtgctgaaaccc
tcgcccgagacgcccttggacgcctatctcctcgccgaactcctctcccgcgccgggctg
cccgacggcgtcgtgaatatcgttcccgcgcatcgtgaaccgagcgagtatctggtgacc
catcccggcgtcgacatggtgtcgttcaccgggtccaccggcgcgggccgccggatcggc
tcgctgtgtggtggcctcgtccggcgggtcgcgctggaactgggcggcaagtcggccgct
gtcgttctcgacgatgccgatctggaatccactgtctcggccctgcggacgggagcgttc
cgcaataccgggcaggtgtgcagttccaagacccgggtggtggtatcccgcaggcgcgca
gcggaattcgccgatgcgctgcgcgatgcgaccgagggtatgccggtgggagatccgtcc
gatccccgtaccgaattcggcccgttggtgtcgtcgcggcagcgtgaagcggtcgagggg
tacatccggtccgggcgtgccgaaggcgccaccgtcgtcctgggaggtgggcggccgcac
gggctggacaccggctggttcgtcgagccgaccatcttcgccggggtgcgcccggatatg
cgtatcgcgcaggaggagatcttcgggccggtgctgtcgattctcgaatacgacaccgag
gacgaggcgatcgagatcgccaacgactcctcgtacggactcaacggcgcgatcttcacc
gccgatccgcagcacgcggtcgcgctggccgagcggatccgcaccggaaccgtggagatc
aacggtaatccggtggggttggccgcgcccgtcggcggtgtcaaggacagcggtgtgggc
cgggaactcgggcccgagggtttcgacgagttcatcgaattcaaatcgatcggcctgcca
cgcgatctcgccctcggatga

DBGET integrated database retrieval system