KEGG   Nocardia nova: NONO_c28580Help
Entry
NONO_c28580       CDS       T03032                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
nno  Nocardia nova
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PaaB
Motif
Other DBs
NCBI-ProteinID: AHH17650
UniProt: W5TE79
LinkDB All DBs
Position
3123927..3125393
Genome map
AA seq 488 aa AA seqDB search
MVYQGNYSKLFIGGRWADPTATEQIAVISPYTEQTVAHVPNSAASDVDRAVAAARHAFDH
GPWPRLSLAERIEVLTRVSAGLGERQEEIAELITTEMGSPITLSRSTQSLGAKLLLDAFL
GLAPSYEWSSIRRSATGTGLVTREPVGVVAAVIPWNMPLQIAMLKLGPALLAGCTVVLKT
APEAPLNGYILAEILQAAGLPDGVVNILPADRGVSEHLVTHPDIDKVSFTGSTAAGRRVA
ELCGRDLRRVTLELGGKSAAIVLDDADLELAIGQIRKLSMRNNGQACSNKTRIVVARSRE
AELVERLVAMVESMPVGDPADAATEIGPVVSARQRAMIESYLEIGRGEGAKVAVGGGRPA
GLDRGWFVEPTIFTGVAPDMRIAQEEIFGPVLSVLSFADEDEAVAIANNSRFGLNGSVFA
ADDEHALAVARRIRTGTVELNGNVVGFHSPIGGFKCSGIGREAGLEGFDGYVESKSYGLS
PSLVESLS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcagggcaactactcgaagttgttcatcggcgggcgctgggccgaccccacc
gcgacggagcagatcgcggtgatctcgccgtataccgaacagacggtggcgcacgtgccg
aattcggcggccagcgatgtcgatcgtgccgtcgcggcggcccggcacgccttcgatcac
ggtccgtggccgcggttgtcgctggccgagcggatcgaggtgttgacccgcgtcagcgcc
gggctgggggagcggcaggaggagatcgccgagctgatcacgaccgagatgggcagcccc
atcacgctgtcgcgcagcacccagtcgctgggcgcgaagctgctgctggacgccttcctc
ggactggcgccgagctacgagtggagcagtatccggcgttcggccacgggcaccggcttg
gtgacgcgggagccggtaggcgttgtcgccgcggtcattccgtggaacatgccgttgcag
atcgccatgctcaagctcggtccggcgctgctcgccgggtgcacggtggtactcaagacc
gcgcccgaggcgccgctgaacggctacatcctcgccgagatcctgcaggccgcgggtctg
ccggacggcgtggtgaacatcctgcccgccgaccgcggggtcagcgaacacctggtcacc
catcccgatatcgacaaggtgtcgttcaccggctccaccgccgcgggacgccgggtcgcg
gagctctgcgggcgggacctgcgccgcgtcaccctggaactgggcggcaagtcggcggcg
atcgtgctcgacgatgccgatctcgaattggcgatcggccagatccgcaagctctcgatg
cgcaacaacggccaggcgtgcagtaacaagacccgcatcgtggtggcccgctcccgcgag
gccgaactggtcgagcggctggtcgcgatggtcgaatcgatgccggtcggcgatccggcc
gatgcggcgaccgagatcggtccggtggtcagcgcccgccagcgcgcgatgatcgagagc
tacctcgagatcggccgcggcgagggcgcgaaggtcgccgtcggcggcggcaggcccgcc
ggactggaccggggatggttcgtggagccgacgatcttcaccggcgtcgcaccggatatg
cgtatcgcgcaggaggagatcttcggcccggtgctgtcggtgctgagcttcgccgacgag
gacgaggccgtcgcgatcgccaacaactcgaggttcggtctcaacggttcggtgttcgcc
gccgacgatgagcacgcgctggcggtggcgcgccggatccgcacgggcacagtggaattg
aacggcaacgtggtgggcttccactcgcccatcgggggattcaagtgcagtggcatcggc
cgggaggccgggctggaggggttcgacggatatgtcgagtccaagtcctacggtctgtcg
ccgtcactggtggaatcgctgtcctga

DBGET integrated database retrieval system