KEGG   Nocardia nova: NONO_c45410Help
Entry
NONO_c45410       CDS       T03032                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nno  Nocardia nova
Pathway
nno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
nno01130  Biosynthesis of antibiotics
nno01230  Biosynthesis of amino acids
Module
nno_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NONO_c45410 (aroK)
Enzymes [BR:nno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NONO_c45410 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA Cytidylate_kin2 Cytidylate_kin AAA_17 AAA_22 RuvB_N AAA_16 Zeta_toxin AAA_24 AAA_5 AAA_28 Rad17 AAA_29 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AHH19325
UniProt: W5TJ11
LinkDB All DBs
Position
4952140..4953294
Genome map
AA seq 384 aa AA seqDB search
MIVRSDPNRPAAILIGPPGAGKSTIGRKLARELGVTLYDTDAGIEEDTGRSIPEIFAADG
EPEFRRIEERVVRRAIMSEDGVVSLGGGAILSEATRELLRGRTVVYLEISVAEGLRRTGA
STNRPLLNGDDPSAKYRELMRIRRPLYREVAAIRVRTDGRSPGRVVRAILVKLGIEPTET
AAAQPVPTQADSTGARRSRSRGRRRRSRTGPSQSAPPGDDPGTETAADAAESGPAQPDSE
ATGAAQPRKRARRSRRGGRRHARNRTTAAQDNAGSMATAPGTTASPPTARAANHPAPASN
SRAGRVRRTASRPAGPPAPNTGAATHPERTEPGSATEGAAAPDPPGPGAERSDHESAPGA
GRSRRARARRARLRRALEESEQHT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttcgcagcgacccgaaccgccccgccgcgattctcatcggcccgccgggggcg
ggtaagtccacgatcgggcgcaaactcgcgcgtgaactgggtgtcacgctgtacgacacc
gatgcggggatcgaggaggacaccggtcgcagcattccggagatcttcgccgccgacggt
gaaccggaattccgtcgcatcgaggagcgggtcgtgcggcgcgcgatcatgtccgaggac
ggtgtcgtctcgctcggcggcggtgcgatcctgtcggaggcgacccgtgagttgctccgc
gggcgcaccgtggtctatctggagatcagcgtcgccgagggactgcgccgcaccggcgcg
tcgacgaaccgccccctgctcaacggcgatgatcccagcgcgaaatatcgcgaactgatg
cggatccgccgcccgctctaccgcgaggtcgccgccatccgggtccgcaccgacggccgc
agtccgggccgggtggtccgcgcgatactcgtcaaactcggtatcgagcccacggaaacc
gctgcggcacaacctgttccgacacaggccgacagcaccggggcccggcgctcccggtcc
cgcggcaggcgtcggcggtcccggaccggcccatcgcaatcggcgcctcccggtgacgat
cccgggaccgagaccgccgccgatgctgcggaatccggaccggcacaaccagattccgaa
gccaccggtgcggcacagccgcgcaagcgcgcacgccggtcccggcgcggcgggcgcagg
cacgcacgcaaccggacgacagcggctcaggacaacgccgggtcgatggccaccgccccc
gggacgaccgcgtccccgcccaccgcgcgcgccgcgaatcatccggcaccggcgtcgaat
tcacgcgcgggccgggtccggcgtaccgcgtcccggcccgccgggccccccgcaccgaac
accggcgccgccacccacccggagcggaccgagccgggttccgccacggaaggcgcggcc
gccccggatccgcccggcccgggcgccgagcgatccgatcacgaatccgcccccggggcc
gggcgatcccgccgggcccgcgcccgccgcgcacgcctacgacgagcactagaggaatcg
gagcagcacacatga

DBGET integrated database retrieval system