KEGG   Nocardia nova: NONO_c54840Help
Entry
NONO_c54840       CDS       T03032                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nno  Nocardia nova
Pathway
nno00250  Alanine, aspartate and glutamate metabolism
nno00410  beta-Alanine metabolism
nno00640  Propanoate metabolism
nno00650  Butanoate metabolism
nno01100  Metabolic pathways
nno01120  Microbial metabolism in diverse environments
Module
nno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NONO_c54840
   00650 Butanoate metabolism
    NONO_c54840
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NONO_c54840
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NONO_c54840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nno01007]
    NONO_c54840
Enzymes [BR:nno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NONO_c54840
Amino acid related enzymes [BR:nno01007]
 Aminotransferase (transaminase)
  Class III
   NONO_c54840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHH20264
UniProt: W5TM95
LinkDB All DBs
Position
5987784..5989025
Genome map
AA seq 413 aa AA seqDB search
MTALSPVLKQATPVVVDHGEGCYLYDTDGRRYLDFTAGIGVTSTGHCHPRVVEAAREQIG
SLIHGQYTTVMHKPLLRLTERLADVLPSHLDSLFFANSGSEAVEAALRLSRQATGRPNVV
VFHGGFHGRTVATASMTTSGTRFSAGFSPLMSGVHVAPFPTAYRYGWSEEQATDFALREL
DYILTTLTAPNETAAFIVEPVLGEGGYIPGNTRFFQGLRERADRHGILLVLDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAAPRELMAKAWPGSQGGTYGGNAVACAA
AVATIDVIESEGLVDNAAARGEQLLAGARTAATKPVGDVRGLGLLVGSEFTTATGEPDTA
TAAAAQQLAAKHGLLLLTCGAYSNVVRMIPPLIVTSEQIDEALAVWGRVLDEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgcactttcccccgttctgaagcaggccacgccggtcgtcgtcgatcatggtgaa
ggctgctatctgtacgacaccgacggtcgccgctatctggatttcacggccggaatcggc
gtcaccagcaccgggcactgccacccgcgcgtggtcgaggccgcgcgcgaacagatcggc
agcctgatccacggccagtacacgaccgtgatgcacaagccactgctgcgcctgaccgaa
cgcctcgccgatgtgctgccgtcgcatctggattcgctgttcttcgccaactccggcagt
gaggccgtcgaagcggcgctgcggctgtcccgccaggccaccggacgacccaatgtcgtg
gtgttccacggcggattccacggccgcaccgtcgcgaccgccagcatgaccacctccggc
acccgcttctcggccggattcagcccgctgatgagcggcgtgcacgtggcccccttcccc
accgcctaccgctacggctggtcggaggaacaggccaccgacttcgcactgcgcgaactc
gactacatcctgaccacgctcacggcgccgaacgagacggccgcgttcatcgtcgagccg
gtcctgggcgagggcggctacatcccgggcaacacccggttcttccaggggctgcgcgag
cgggccgaccggcacggcatcctgctggtgctcgacgagatccagaccggattcggccgc
accggaaagttcttcggccatcagcacttcgatgtgcgaccggacatcatcaccatcgcg
aagggtctggccagcggcttcccgctgtcgggtatcgcggcgccgcgcgagctgatggcg
aaggcgtggcccggctcccagggcggaacctacggcgggaacgcggtggcgtgcgcggcc
gcggtggcgaccatcgatgtcatcgaatccgagggactggtggacaacgccgccgcccgc
ggcgagcagttgctcgccggggcccgcaccgccgccaccaagccggtcggcgacgtacgc
gggctcggactgctcgtcggcagcgaattcaccaccgcgacaggcgaacccgacaccgcc
accgcggctgcggcacagcagctggccgcgaaacacggcctgctcctgctgacctgcggc
gcctacagcaatgtcgtgcgcatgatcccgccgctgatcgtgacctccgagcagatcgac
gaggcgctggccgtctgggggcgcgtcctcgacgaactgtag

DBGET integrated database retrieval system