KEGG   Nocardia nova: NONO_c73860Help
Entry
NONO_c73860       CDS       T03032                                 

Definition
(GenBank) putative acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nno  Nocardia nova
Pathway
nno00071  Fatty acid degradation
nno00410  beta-Alanine metabolism
nno00592  alpha-Linolenic acid metabolism
nno00640  Propanoate metabolism
nno01040  Biosynthesis of unsaturated fatty acids
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
nno01200  Carbon metabolism
nno01212  Fatty acid metabolism
Module
nno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NONO_c73860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NONO_c73860
   00592 alpha-Linolenic acid metabolism
    NONO_c73860
   01040 Biosynthesis of unsaturated fatty acids
    NONO_c73860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NONO_c73860
Enzymes [BR:nno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     NONO_c73860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 DUF4101
Motif
Other DBs
NCBI-ProteinID: AHH22141
UniProt: W5TY37
LinkDB All DBs
Position
complement(8037952..8039721)
Genome map
AA seq 589 aa AA seqDB search
MVTHGYQERTSLAGLLRHGSLDFHQQLQKILSDPDYAVTEKQSQEQRRENAYSQLRHLVS
EIGSTRTVATDLPKLFAVFDWAAVLATDLIPLISGHYNLASGSLATLTDSDSAAPYLHDL
DDGDAIGVMLLTEYGCGSNIGFMQTRATWDGSGFVINTPNRRARKFMPSVGIPVARVCVV
GARYIDSAGVDQGVHLFAARLRDADGRPAPGVSITQLDHQPLVIMDNSVIEFDNLRVERS
AWLGNDLATIDDDGVLTWRDESSRRKGFASAISQLTVGRLALSSCLNATALASLYIALRY
AAKREVPLTLTDRPPMLDIPHVRDTLLTDLAGTVARRIYGNSVKTFLANSDLTDRDTVVT
VMLAKRFIQLHALETVTHCRIKMGAQGMFSANRVADYLGVNHAAITGEGDCDVLGSVAGR
VLARYLAGKPVPESGLHDPADIDDRLSLLNARTLTIVQEAQAYLTTSDLADRLAIVPSAL
DLAEAYSAEQTLQLLHQHADQPEIAAVRDVYALHYLVEHAEWYLTHDLLDNVGVRTVKQK
LRDAIDNLVGHLPTLLNAFGFDDEILAAPVLSDDIPTAWDDRIHQPDRH
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggttacgcacggctaccaggaacgaacatcgctggctggacttctccggcacggcagc
ctggacttccaccagcaactgcagaagattctcagtgatccggactacgccgtcaccgag
aagcagagccaggaacagcgacgagagaatgcctactctcagctgcggcatctggtcagc
gagatcggtagcactcgcacagtcgccaccgatctgcccaagttgttcgctgtgttcgac
tgggccgcggtactggccaccgacctgatcccactgatctccggccactacaacctggcc
tcgggcagcctggccaccctgaccgactccgactcggccgcaccgtatttgcacgacctg
gacgacggggacgccatcggcgtcatgctcctcaccgagtacgggtgtggctccaatatc
ggattcatgcagactcgcgccacgtgggacggctcagggttcgtgatcaacacaccgaac
cggcgagcacgcaaattcatgccgagcgtcggtatccccgttgccagggtctgcgtcgtc
ggagcccgctacatcgactcggcgggtgtggaccaaggcgttcatctgttcgccgcacgt
ctgcgtgatgccgatggccgacccgcccccggcgtctcgatcacccaattggaccatcaa
ccgctggtcatcatggacaactcggtcatcgagttcgacaacctccgggtcgagcgcagc
gcctggctgggtaacgatctcgccaccatcgacgacgacggcgtactgacatggcgggac
gagagcagccgccggaagggattcgcctccgcgatcagccagctgaccgtggggcgatta
gcactctcatcgtgcttgaatgccaccgccctggcctcgctctacatcgcgctgcgctac
gccgccaagcgagaggtgccactgactctgacagaccgtccgccgatgctcgacattccg
catgtgcgcgacacgctcctcaccgacctggcagggactgtcgcgcgccggatctacgga
aattcggtcaaaaccttcctggcgaacagcgatctcaccgatcgagacaccgtcgtgacg
gtgatgctggccaagcggttcatccagctgcacgccttggaaaccgtcacccactgccgg
atcaagatgggcgcgcagggaatgttcagcgccaaccgggtcgccgactacctcggcgtc
aatcacgcggccatcaccggtgagggcgactgtgatgtcctcggttccgtcgccggtcgc
gtgctggccagatacctcgccggaaagccggtaccggagtccggtctgcacgacccggcc
gacatcgacgaccgcctgagtttgctcaacgcacgcactctcacgatcgtgcaggaggca
caggcgtacttgacgacatcggatctcgcggaccggctcgctattgttccctcagcgctc
gacctcgcggaagcgtacagcgcggaacagaccctgcaactgctccatcagcacgccgac
cagcccgagatcgccgcggtgcgtgatgtttacgcgctgcactaccttgtggaacacgcg
gagtggtatctcacccacgatctgctggacaacgtcggcgtccgcacggtcaaacagaaa
ctccgcgatgccatcgacaacctcgtcggtcacctgccgacgttgctgaacgcattcgga
ttcgatgacgaaatcctcgccgcaccagtactttccgatgacatacccactgcgtgggac
gaccggattcaccaaccggaccgtcattga

DBGET integrated database retrieval system