KEGG   Nelumbo nucifera (sacred lotus): 104586329Help
Entry
104586329         CDS       T04131                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00564  Glycerophospholipid metabolism
nnu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104586329
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104586329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA Lycopene_cycl HI0933_like NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104586329
NCBI-ProteinID: XP_010241819
UniProt: A0A1U7Z3G1
LinkDB All DBs
Position
Un
AA seq 629 aa AA seqDB search
MATATRLKGFGAAVIAVAGAYGALSLRDPVLSENDRGHFHSIRKKINDVNAVVPSREVQE
SALMGASSANPLDVLVVGGGATGCGVALDAASRGLRVGLVEREDFSSGTSSRSTKLIHGG
VRYLEKAVFNFDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWIGLK
LYDLVAAKRLLHLSRYYSAQESIELFPTLARKGKDKSLKGTVVYYDGQMNDSRLNVGLAC
TAALAGAAVLNHAEVVAFLKDDVTERIIGARIRNNLSGKEFDTYAKVVVNAAGPFCDSVR
KLANKDAQPMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTTDSS
TTITMLPEPHEDEIQFILDAICDYLNVKVRRADVLSAWSGIRPLAMDPSAKNTESISRDH
VVSEDYPGLLTVTGGKWTTYRSMAEDAVDAAIKSGKLSPTNGCLTNHLQIVGGDGWDPAS
FTVLAQQYVRMKKTQNGKVVPGIMDSAAAKHLSQAYGTLAERVATIAQNENLGKRLAHGY
PFLEAEVAYCARYEYCESAVDFIARRSRLAFLDTDAAGRALPRVIQILGAEHKWDKSRQK
QELQKAREFLVAFKSSKNAQFHDGKHTGL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctacagctactcgattgaagggcttcggcgctgccgtaatagccgtcgccggagct
tacggtgcattgagcctcagggatccagttctgtctgagaacgaccgagggcatttccac
agcatccggaagaagatcaatgacgtcaacgctgtcgtcccttcgcgggaagtccaagaa
tctgctttgatgggcgccagctcagccaatcctctcgacgttcttgttgtcggtggtggc
gcgaccgggtgtggggtggcactggatgccgcgtcaaggggacttcgcgttggcctcgtc
gagagagaggatttctcctccgggacttcttcgagatccaccaagttaattcatggtggg
gttcgctatttggaaaaagctgtctttaattttgactatgggcaactgaaactggttttt
catgcacttgaggagcgtaaacaagttattgaaaatgctccacacctatgccatgctttg
ccatgcatgacaccgtgtttcgactggtttgaagttgtatactactggataggattgaaa
ctatatgatctggttgcagcaaaacgcttgctacatttgtcccgatattactctgcacaa
gaatcaattgaactctttccgactcttgcacggaagggtaaagataaaagcttgaagggt
acagttgtgtactatgatggacagatgaatgactccagacttaatgttggactggcatgc
actgctgcattagctggtgcagcagtgcttaaccatgcagaagtggtggcttttcttaag
gatgatgttacagaaaggataattggtgcacgtatccgaaacaatctgtcaggcaaagag
tttgatacatatgcaaaagttgttgtgaatgctgctgggccattttgtgactctgtgagg
aaacttgcaaacaaagatgcacagcccatgatttctcctagcagtggagtgcacattgtt
ctccctgattattattctcctgagggaatgggcttaattgttccaaaaaccaaagatgga
cgtgttgttttcatgctgccatggttgggaagaacaattgcaggaacaacagattccagt
actacaattaccatgcttccagaaccgcatgaagatgagatacaatttatactggatgcc
atttgtgattaccttaatgttaaggtacgtcgtgcagatgttctctctgcttggagtggc
attcgtccattggccatggacccatcagcaaagaacactgaaagcatttctagggatcat
gtagtttctgaagattaccctggtttgctcactgttactggtggaaaatggactacatac
agaagcatggcagaggatgcagttgatgcggctataaaatctgggaagttgagtccaaca
aatggctgcttgactaaccacctacaaatcgttgggggagatggttgggatccagcttca
tttacagttcttgctcaacaatatgttcgtatgaagaagactcaaaatggtaaagttgtt
ccagggataatggacagtgctgcagccaaacatctatctcaagcttatggtactttagct
gaacgagtggcaaccatagctcagaatgaaaatcttgggaagcgacttgcccatggatac
ccttttttagaagcagaggttgcatattgtgctcggtatgagtactgtgagtctgctgtg
gatttcattgctaggagatccagacttgcttttcttgatactgatgcagcaggcagggca
ttgccacgtgtaattcaaatattgggtgctgagcacaagtgggacaaatcaaggcagaag
caagagttacagaaggcaagggaattcttggtagcttttaagtcatctaagaatgctcaa
ttccatgatggaaagcatacagggttgtaa

DBGET integrated database retrieval system