KEGG   Nelumbo nucifera (sacred lotus): 104587340Help
Entry
104587340         CDS       T04131                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104587340
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104587340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104587340
NCBI-ProteinID: XP_010243203
UniProt: A0A1U7Z860
LinkDB All DBs
Position
Un
AA seq 217 aa AA seqDB search
MQALLAAMAAHTIIAASPPQPLLSSFSNPSLSLQSSFVGLSIKFPRQSLKFAVASKPLTV
VAETKKAVAVLKGNSQVEGVVSLTQEDNGPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCI
STGAHFNPNKMTHGAPEDEIRHAGDLGNIVANADGVAEATIVDNQIPLSGPNAVIGRAFV
VHELEDDLGKGGHELSLTTGNAGGRLACGVVALTPVQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgctattggcagccatggcggcccacaccataatcgcagcttctcctcctcaa
cctctcctttcttccttctcaaaccctagcctttctctccaatcttccttcgttggtctc
tccatcaaattccctcgccaatccctcaagttcgccgttgcatcgaagcccctcacagta
gtcgctgagacgaagaaagccgtggctgtcctcaagggcaattcccaagtcgagggtgtt
gtcagcttgacccaagaagacaatggcccgacgactgtaaatgtccgtgttaccggactt
actcctggacctcacggcttccaccttcatgagtatggtgatacgacgaatgggtgcata
tctacaggggcacattttaacccaaacaaaatgacacatggtgctcctgaggacgaaatc
cgtcatgcgggtgacctgggaaacatagttgctaatgccgatggtgtggccgaggcaaca
atcgttgataaccagataccactgagtggacccaatgccgtcattggaagagcatttgtg
gttcatgaactagaggatgaccttggaaagggtgggcatgaacttagcctcaccactggc
aatgcagggggaagattggcatgtggcgtggttgctttgactccagttcagtga

DBGET integrated database retrieval system