KEGG   Nelumbo nucifera (sacred lotus): 104589582Help
Entry
104589582         CDS       T04131                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00250  Alanine, aspartate and glutamate metabolism
nnu00410  beta-Alanine metabolism
nnu00430  Taurine and hypotaurine metabolism
nnu00650  Butanoate metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Module
nnu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104589582
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104589582
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104589582
   00430 Taurine and hypotaurine metabolism
    104589582
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104589582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104589582
NCBI-ProteinID: XP_010246277
UniProt: A0A1U7ZE65
LinkDB All DBs
Position
Un
AA seq 494 aa AA seqDB search
MALSKTASESDVSVHSTFASRYVRTSLPRFKMAEKSIPKEAAYQIISDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAGINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPCDSPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKETGWETP
IHVDAASGGFIAPFIYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCRENTMVLKEGLEK
TERFNIVSKDEGVPLVAFSLKDSSHYTEFQVSDMLRRFGWIVPAYTMPPDAQNITVLRVV
IREDFSRTLAERLVHDIQKVLHDLDTLPAKISAKLALNGEEGILPRKKSAIETQREITTA
WRKFVMARKTNGVC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccaaaactgcgtcggagtccgatgtctccgttcattctaccttcgcttcg
cgctacgtccgaacttctcttcccaggttcaagatggcagagaagtcgatcccgaaggaa
gcggcgtaccagatcattagcgacgagctgatgctggacgggaaccccaggctgaaccta
gcctccttcgtgacgacatggatggaaccggagtgcgacaagctcataatggctggcatc
aacaagaactatgtcgacatggacgagtaccccgtcaccaccgagctccagaaccggtgc
gtgaacatgattgcacatttgttcaacgctccactcggagaatcagaggctgccgtcgga
gtagggactgtggggtcgtcggaggcgattatgttggccggactggcattcaagaggaag
tggcagaacaagaggaaggccgagggtaaaccctgtgacagtcccaacatcgttacgggt
gctaatgttcaggtctgttgggagaaatttgcaaggtactttgaggttgagttgaaggag
gtaaaactgagggaaggctactatgtgatggaccctgagaaagcagttgagatggttgat
gagaacaccatctgtgtcgctgcaatcctcggttccaccctcaatggtgaatttgaggat
gttaagcgtttgaatgacctattgatagagaagaacaaggaaacaggatgggaaactcct
attcatgttgatgctgccagtggtggattcattgctccattcatctacccagacctagag
tgggacttccgcttgccactggtgaagagtatcaatgtcagtggccacaagtatggtctt
gtctatgctgggattgggtgggtcatctggaggagcaaagaagatttgcctgaagaactc
atcttccacatcaactatcttggagctgatcagcccacctttaccctcaacttctctaaa
ggttctagtcaagtaattgctcaatactaccagctaattcgcttgggctatgagggctat
aggaacattatggagaattgcagagaaaatacaatggttctcaaggaaggattagagaag
acagagcgtttcaacattgtgtccaaggacgaaggagtccccttggtggcattctcactc
aaggacagtagccattacactgagttccaagtgtcggacatgttgcgccgattcggatgg
attgtgccagcctataccatgccacctgatgctcagaatataacagtgctccgtgttgtt
ataagggaggatttctctcgaactcttgctgagagacttgtccatgacatccaaaaggtc
cttcatgacctcgacaccctccctgcaaagatctctgcgaagctagcactcaatggtgaa
gagggtattcttccccgcaagaagagtgccattgagacccagagagagatcactacagca
tggaggaagtttgtgatggccaggaagaccaatggtgtttgttaa

DBGET integrated database retrieval system