KEGG   Nelumbo nucifera (sacred lotus): 104591070Help
Entry
104591070         CDS       T04131                                 

Definition
(RefSeq) DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu03030  DNA replication
nnu03410  Base excision repair
nnu03420  Nucleotide excision repair
nnu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104591070
   03410 Base excision repair
    104591070
   03420 Nucleotide excision repair
    104591070
   03430 Mismatch repair
    104591070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nnu03032]
    104591070
   03400 DNA repair and recombination proteins [BR:nnu03400]
    104591070
Enzymes [BR:nnu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104591070
    6.5.1.6  DNA ligase (ATP or NAD+)
     104591070
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104591070
DNA replication proteins [BR:nnu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104591070
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104591070
DNA repair and recombination proteins [BR:nnu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104591070
   NER (nucleotide excision repair)
    Other NER factors
     104591070
   MMR (mismatch excision repair)
    Other MMR factors
     104591070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL Lactamase_B_2 UBA_4 RMMBL DNA_ligase_A_N
Motif
Other DBs
NCBI-GeneID: 104591070
NCBI-ProteinID: XP_010248167
UniProt: A0A1U7ZK14
LinkDB All DBs
Position
Un
AA seq 871 aa AA seqDB search
MAFPPSSTTKTLTLNSSELFVDSYKAFSQKSPQNSPPRSFTLLSQRSPLPPIPSDFAQSK
LIPKTRFIVDGFRYSGDYSVSYFLSHFHSDHYAGLKTGWSKGLIFCSETTGRLLIEALKL
SSLFVISLSLGEPVVIDGCEVTLVDANHCPGAVQFLFKIPRTEGKYERYVHTGDFRFCDS
MTLEPVLSEYVGADAVFLDTTYCNPKFVFPSQDDSVNYIVEAIERIRAENQRLRESVLFL
IATYVVGKERILVEISRRCNCMIHVDSRKMSILCILGFGGGGIFTEDVSVTDVHVVSWNV
LGETWPYFRSNFAKMEEIMIERGYTKVVGFVPTGWMYEVRKDGFAVRTKDSFEIHLVPYS
EHSSYNELREYVRFLRPKRVIPTVGLDVEKLDSKHAVAMQKHFAGLVDEMANKQEFLMGF
HRKSRNKDEKEKGNISSDSNKELDKENEVKQSKEILERSPALREPDLQNSSMASDRDMEE
SIKEICDSLPPWVTREQMLDLLKHTKGNIVEAMSEFYERETELREQLTASNRSTTSQLNL
STISYTSLACISSSLPEMGSVKEHFIGIMKNSLVQDKKLSNMRRSIKSTVSPRKKATGVE
NKSNKKAKLGSFSESCRSDSKQYTITKFFSKIVPNASQVGEIGTDMAEQFPDTRNVLSSN
MSELYKEEINQFLEVIDGGLSRIDAASILEKAKGDIHVALDVYYNNSGVDCDDNDGKLSV
QSQPYIDNCSSGKETKSSEESENIPSLFMQGFSTTDVTATLVSLPLEKYSPVEHACWRQG
QPAPYLHLARTFDLVEGERSKIKATGILCNMFRSLLALSPKEVLPAVYLCTNKIAADHEN
MFLFEKEMDRPKSHSISSCEFIYVVLTAVFR
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcctccatcttccaccacaaaaaccctaaccctaaattcttccgaactcttc
gtcgactcttacaaagctttctctcagaaatctcctcaaaactctccacctcggtctttc
actcttctctctcaacgatctcccctccctcccattccatctgatttcgctcaatccaaa
cttatccccaaaacccgttttatcgttgacgggttccggtactccggcgattactccgtt
tcctatttcctctctcatttccactccgatcactacgcaggcttaaaaactggttggtct
aaaggtctcatcttttgttcagaaactacaggtcggcttcttattgaagctctaaaacta
tcttctctatttgttatttccttgtcacttggtgaaccggttgttatcgacgggtgcgaa
gtcactcttgttgatgcgaatcactgccctggtgcggttcaatttttgtttaagatacct
agaactgagggaaagtatgagaggtatgtccacactggggatttccggttctgtgattcg
atgacactagagcctgttctaagtgaatatgtcggagcggatgcggttttcttggatacg
acatactgtaatccgaagttcgtttttccgtcacaagatgattcggttaattatatagtt
gaagcaatagagagaattagagctgaaaatcaacggttgagggagtctgtgttgtttcta
attgctacgtatgttgttgggaaagagagaatcctggttgaaatttcgcgtagatgtaac
tgcatgatacatgtagatagcaggaaaatgtcaattttatgtattttagggtttggcgga
ggtgggatatttacagaggatgtttcggttactgatgttcatgtggttagctggaatgtg
ttaggcgagacttggccttattttaggtctaattttgccaaaatggaggagattatgatc
gagagagggtacacaaaggtggtaggttttgttccaactgggtggatgtatgaagtaagg
aaagatgggtttgcagtaaggacaaaggattcatttgagatccatcttgtaccatacagt
gaacattcaagctacaatgagctgagagagtatgttaggttcttgagaccaaaacgtgtt
attccaaccgttgggttggatgttgagaagcttgatagcaaacatgctgtggcaatgcag
aagcattttgctgggttggttgatgagatggccaataagcaagaattcttaatggggttt
cacaggaagtctaggaacaaggatgaaaaagaaaaaggtaacattagcagcgactcgaac
aaggaacttgataaagagaatgaggtgaagcaatctaaagagattttggaaagatcacct
gccctgcgagaacctgatttacaaaattcaagcatggcaagtgatagagatatggaggag
tcaattaaagagatttgtgatagcttgccaccctgggttactcgggaacagatgttagat
ttgcttaaacacacaaagggaaatattgttgaagcaatgtctgagttctatgaacgtgaa
acagaactgcgtgagcaattaactgcttcaaacaggtctacgacttctcaattgaacttg
tctactatttcttatacaagtttggcatgcatttcttcatcacttcctgaaatgggatct
gttaaggaacactttattggaattatgaaaaatagtttagttcaagacaagaagctatcc
aacatgaggcgttcaattaagagcaccgtctctcctaggaaaaaggcaacaggtgtggag
aataagtcaaacaagaaagcaaagctaggttcattttcagaatcttgcaggtccgattcc
aaacaatacacgataacaaagttctttagtaagattgtccctaacgcatcacaagttggt
gagattggtactgatatggctgagcagttccctgatactaggaatgtattgtccagtaac
atgagtgagttatacaaggaagagataaatcagtttcttgaagtcatagatggtggtcta
tcaagaattgatgctgcctctatcctagagaaagccaaaggggatattcatgtagcccta
gatgtatattataataattctggggtggattgtgatgacaatgatgggaagttatcagtt
caaagccaaccttacattgataattgttcttctggaaaagagacaaaatcatctgaggaa
tcagaaaatattcctagcctatttatgcaagggttttcaacaacagatgtgactgcaact
cttgtatcactaccactagagaagtattcccctgttgagcatgcatgctggaggcaagga
cagcctgctccatatttacatcttgcacgaacttttgatctggtggaaggagaaagaagc
aagataaaagctactggtatcctgtgcaacatgttcagaagcttgcttgccttatcgccc
aaagaagtgctaccagctgtttatttgtgtacaaataagattgctgctgatcatgaaaat
atgtttttgtttgaaaaagaaatggacaggcccaagtctcactccatatcttcatgtgag
tttatttatgttgttttgacagctgtgtttaggtag

DBGET integrated database retrieval system