KEGG   Nelumbo nucifera (sacred lotus): 104592043Help
Entry
104592043         CDS       T04131                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00010  Glycolysis / Gluconeogenesis
nnu00051  Fructose and mannose metabolism
nnu00052  Galactose metabolism
nnu00500  Starch and sucrose metabolism
nnu00520  Amino sugar and nucleotide sugar metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Module
nnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nnu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104592043
   00051 Fructose and mannose metabolism
    104592043
   00052 Galactose metabolism
    104592043
   00500 Starch and sucrose metabolism
    104592043
   00520 Amino sugar and nucleotide sugar metabolism
    104592043
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104592043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nnu04131]
    104592043
Enzymes [BR:nnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104592043
Membrane trafficking [BR:nnu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104592043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Sir1
Motif
Other DBs
NCBI-GeneID: 104592043
NCBI-ProteinID: XP_010249484
UniProt: A0A1U7Z7W5
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MGKVVVGAAVICAATVCAAAALIVRHRMRCSGRWARAMAILREFEEKCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGNERGLFYALDLGGTNFRVLRVQLGGKDGR
VVNQEFAEVSIPPHLMTGGSEELFDYIAAELAKFVKTEGEDFHLSPGRQRELGFTFSFPV
RQLSITSGTLIKWTKGFSIEDVVGQDVVLELTKALEKQGLDMRVAALVNDTIGTLAGGRY
LNNDVIAAVILGTGTNAAYVECANAIPKWHGLLPKSGEMVINMEWGNFRSSHLPITEYDH
ALDVESLNPGEQIFEKIISGMYLGDIVRRVLLSMAEEAAFFGDTVPPQLKVPFILRTPDM
SAMHHDTSPDLKVVGNKLKDILGIPNTSLKTRKAVVELCNIVATRGARLSAAGILGILKK
LGRDVVKEGEKQRTVLAMDGGLYEHYTEFRVCLESTLKELLGEEVSANVSVEHSNDGSGI
GAALLAASHSQYLEVEDS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggttgttggagctgcggtgatatgtgctgctactgtttgcgcggcggca
gctcttatcgttcgccatcggatgcgatgctcaggccgttgggctcgggcgatggctatc
cttagggaatttgaagagaagtgtgcgacaccgattgggaagctcagacaagtggctgac
gccatgacagtcgagatgcatgctggtcttgcgtcagagggagggagtaagctcaagatg
cttatcagctatgttgacaacctccctacagggaatgagagaggattattttatgcattg
gaccttggtggaacaaacttccgtgtattgcgtgtacagttgggtgggaaggatggacgt
gttgtcaatcaagaatttgctgaggtgtcaattcctccacatttgatgactgggggttca
gaagagctgttcgattacattgctgcagagcttgcaaagtttgttaaaactgaaggtgaa
gattttcatctttctcctggcaggcagagggaactgggttttaccttctcatttccagtg
aggcaattatcaatcacatcagggacccttattaagtggacaaaaggcttcagtattgag
gatgtggttggccaagacgtggttctagagctgactaaggccttggaaaaacaaggtctt
gatatgcgtgtcgcagctctggtcaatgacacaattggaacactagcaggaggtaggtac
ttgaacaatgatgttattgctgctgtaatattgggtaccggtaccaatgcagcatatgta
gaatgtgcaaatgcaattcccaagtggcatggacttctacctaagtcgggggagatggtt
attaacatggagtggggtaatttccgatcttcacatcttcctataacagagtatgatcat
gcattggatgtagagagtttaaaccccggtgaacagatatttgagaagataatctctgga
atgtacttgggagatattgtacgtagagtcttattgagtatggctgaggaggctgccttt
tttggtgacactgttccaccacagcttaaagttccatttatattgaggacacctgacatg
tctgccatgcatcatgacacgtctccagatctcaaggtggtggggaacaaattgaaggat
atcctagggatacctaatacttccttgaaaacaagaaaggccgttgttgagctctgtaac
attgttgccactcgtggagcccgtctttctgcagcagggatcttgggcattctaaagaaa
ttgggaagagatgttgtaaaggagggggagaagcagaggacagtgctagccatggatggt
gggttgtatgagcattacacagagttcagagtgtgcctagaaagcactctcaaggagttg
ctgggagaggaagtttcggctaatgtttctgttgaacattccaatgatggctccggtatt
ggagctgcacttcttgcagcctctcactcccagtatttggaggttgaggattcctga

DBGET integrated database retrieval system