KEGG   Nelumbo nucifera (sacred lotus): 104593233Help
Entry
104593233         CDS       T04131                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00010  Glycolysis / Gluconeogenesis
nnu00053  Ascorbate and aldarate metabolism
nnu00071  Fatty acid degradation
nnu00280  Valine, leucine and isoleucine degradation
nnu00310  Lysine degradation
nnu00330  Arginine and proline metabolism
nnu00340  Histidine metabolism
nnu00380  Tryptophan metabolism
nnu00410  beta-Alanine metabolism
nnu00561  Glycerolipid metabolism
nnu00620  Pyruvate metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104593233
   00053 Ascorbate and aldarate metabolism
    104593233
   00620 Pyruvate metabolism
    104593233
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104593233
   00561 Glycerolipid metabolism
    104593233
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104593233
   00310 Lysine degradation
    104593233
   00330 Arginine and proline metabolism
    104593233
   00340 Histidine metabolism
    104593233
   00380 Tryptophan metabolism
    104593233
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104593233
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104593233
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104593233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 104593233
NCBI-ProteinID: XP_010251301
UniProt: A0A1U7ZRD4
LinkDB All DBs
Position
Un
AA seq 534 aa AA seqDB search
MATRRISSLLSRPFAASSLRSLGRNSSWSRGIYRFSTATATEEVITPPVQVEHTQLLING
QFVDAASGRTFPTLDPRTGEVIAHVAEGEDEDINRAVSAARKAFDEGPWPKMTAYERSRI
IYRFADLLEKHNDEIAAIETWDNGKPYEQSAKVEIPMLTRLFRYYAGWADKIHGLTVPAD
GPYHVQTLHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNAVVLKTAEQTPLSALYVSKL
FHEAGLPPGVLNVISGFGPTAGAALASHMDVEKVAFTGSTDTGKIVLELAARSNLKKVTL
ELGGKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHENVYDEFIEKAKARAM
KRVVGDPFKKGVEQGPQIDAEQLEKVLKYIRAGIECGATLETGGERFGTKGYFIQPTVFS
NVEDGMPIATDEIFGPVQSILKFKDLDDVIRRANKSRYGLAAGVFTKNIETANTLMRALR
VGTVWINCFDVFDAAIPFGGYKMSGQGREKGIYSLSNYLQVKAVVSPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcgaaggatctcgtcgctactctctcgaccgttcgctgcttcttcgttacgt
tctctaggcagaaattcaagctggagcagaggcatctatcggtttagcactgctactgcg
actgaagaagtaattactccacctgttcaagttgaacatacccagcttttaatcaatgga
caatttgtggatgcagcatcagggagaacttttcctaccttggatcctaggacgggagag
gtaattgcacatgttgctgaaggtgaggatgaagatattaaccgggctgtctctgctgct
cgaaaggcatttgatgagggaccgtggccaaagatgactgcttatgaaagatcacggata
atatatcgctttgctgatttgcttgaaaagcacaatgatgaaattgcagcaattgagact
tgggataatggaaagccatatgaacagtctgctaaagttgagataccaatgctgacacgc
ctctttcgatactatgctggttgggcagataagattcatggtctcactgtccctgctgat
ggaccataccatgttcaaaccctgcatgaaccaatcggtgttgctgggcagattattcca
tggaactttcctcttctcatgtatgcttggaaggttggacctgcattagcatgtggcaat
gctgttgtattaaagactgcagagcagacacccttatctgctctctatgtgtcaaagcta
ttccatgaggctggtcttcctccgggtgttttaaatgtaatatcaggatttggtccaact
gctggtgcagctcttgccagtcatatggatgtggaaaaggttgctttcacgggatcaact
gatactgggaagattgttcttgaattagctgcaagaagcaaccttaagaaagtgacacta
gagcttggaggaaagtcccccttcattgtctgtgaggatgctgatattgataaggctgtt
gagcttgcacactttgctctgttttttaatcagggacaatgttgctgtgctgggtctcgc
acatttgttcatgaaaatgtatatgatgagttcatagaaaaagcaaaggcacgtgctatg
aagcgtgttgttggtgaccccttcaagaagggtgtagaacaaggtccccagattgatgcg
gaacaattggagaaggtcctaaagtacataagagctggaattgaatgtggtgctactctc
gaaactggaggtgaaaggtttggtaccaaaggctactttattcaacccactgtcttctca
aatgttgaggatggcatgccaattgcaactgatgagatctttggtccagtgcagtccatc
ttgaaattcaaggaccttgatgatgtgatacgaagggcaaacaagagtcgttatgggttg
gctgcaggagtctttaccaagaacatcgagactgccaacaccttgatgcgtgcactaaga
gtagggacagtatggattaattgctttgatgtctttgatgctgcaattccttttggtgga
tacaagatgagtgggcagggcagagaaaaaggaatctatagcctaagcaattacttgcaa
gtaaaggctgttgtttctcctttgaagaatccagcctggttataa

DBGET integrated database retrieval system