KEGG   Nelumbo nucifera (sacred lotus): 104595705Help
Entry
104595705         CDS       T04131                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00020  Citrate cycle (TCA cycle)
nnu00190  Oxidative phosphorylation
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104595705
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104595705
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104595705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 104595705
NCBI-ProteinID: XP_010254866
UniProt: A0A1U7ZS49
LinkDB All DBs
Position
Un
AA seq 634 aa AA seqDB search
MWRCVSRGFRLSSSASSKRSISSEPLKPLISRFFSTQSPRLSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDW
LGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSNGTCQGVIALNMEDGTLHRFHAAS
TILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPEVLKERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVRIKGNDQDA
VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAELHKPGEKQKPLESDAGE
KTIAWLDKLRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFHDVK
LKDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWLKHTL
GYWENEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtggctttcgcctttcttcatctgcttcatcgaagagatcg
atctccagcgaacctcttaaacccctcatctcaagattcttctccactcaatcacctcga
ttatcttacaccattgttgatcacacatacgatgctgttgttgttggagctggtggcgct
gggcttagagcggccattggactctctgagcatgggttcaatacagcttgtattaccaaa
cttttcccaactcgttcacatactgtcgcagcacagggtgggataaatgctgcattagga
aatatgagcgaagatgattggaggtggcatatgtatgacacagtcaaaggaagtgattgg
ttaggtgatcaggattctattcagtacatgtgcagggaggcaccaaaagcagtcatagag
cttgaaaattatggattaccattctctcgaactgaagatgggaaaatatatcagcgtgca
tttggtggtcaaagcctggactttggaaaaggtggacaggcctaccgttgtgcatgtgct
gctgatcgaactggccatgctttgctgcacacattatatggtcaggcaatgaaacataat
acacagttctttgtggaatattttgcattggatcttctaatggacagtaatggtacctgc
caaggagtaattgcactaaatatggaggatgggacactacatcggttccatgctgcttca
acaattttggcaacagggggctatggtagaacttatttttctgcaacctcagctcataca
tgtacaggcgatggaaatgccatggttgcacgtgctgggttacctcttcaggatcttgag
tttgtgcagtttcacccaacgggtatatatggtgctggatgcctaattactgaaggatct
cgtggtgaaggtggtattcttaggaacagtgaaggtgagcggtttatggaacggtatgcc
cctactgccaaggatcttgcatcaagggatgttgtctcaagatctatgacaatggaaata
cgagaaggtcgtggcgtaggaccattgaaggatcacatctatctccacttgaatcactta
cctccagaagttctcaaggagaggcttcctggaatctctgagactgctgccattttttct
ggggttgatgttacaaaggagcccatcccagttttacctactgttcactataatatgggt
ggaatccctacaaaccaccatggagaggtagttcgcattaaaggtaatgaccaagatgca
gtagttcccggattaatggctgctggagaagcagcatgtgcatcagttcatggtgccaat
cggcttggtgcaaattcactacttgatattgttgtttttggccgagcttgtgcaaatagg
gtagcagagctccataaaccaggggagaaacaaaagccattggaaagtgatgctggagaa
aaaaccattgcatggctggataaactaagaaactcaaatggttcattgccaacttcaaaa
atccgtttgaatatgcaacggataatgcaaaacaatgctgctgttttccgtactcaggaa
acattagaagaaggttgtcagttgattgacaaagcatgggaaagctttcatgatgttaag
ttgaaggatcggagcctgatatggaactcagacttgatagaaactatagaattggaaaac
ttattgataaatgcatgtataaccatgcattctgctgaggccaggaaggagagtagagga
gcacatgcccgtgaagattttacgaaaagggatgatgagaactggctgaaacatacactg
ggatactgggagaatgagaaggtccggctagattacagaccagtccatatgaatacatta
gatgatgaggttgagtcattccctcccaaagctcgcgtatattga

DBGET integrated database retrieval system