KEGG   Nelumbo nucifera (sacred lotus): 104597174Help
Entry
104597174         CDS       T04131                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nnu03016]
    104597174
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     104597174
Transfer RNA biogenesis [BR:nnu03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    104597174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB PTPS
Motif
Other DBs
NCBI-GeneID: 104597174
NCBI-ProteinID: XP_010256905
UniProt: A0A1U7ZTL7
LinkDB All DBs
Position
Un
AA seq 793 aa AA seqDB search
MTMAVRAANSCSVFRSVSSPPFSSFPCRLSHFAPSRFRGVSKLRFQAPASRPEKLLPYWG
ILSCSVYSLVESVMEELEVLRARKRVYASSKVGLVSSGQLVEGKVDKRVLQKGLLLEFRK
DSERVLLAVAQKPDGKKNWVVSDQNGVTSSIKPQQITFIVPGVENFDHTEISDFIEKAHK
NLDPTLLEYAWMELLEKNKSVTAEELAEIIFGSVEPVESYCAHLLLSKDEVYFSVVEAKG
SHSVYGPRPAVQVEELLRRKHAKEEAEKELQEFVGLLMSAKGVSLHSKPPKESWTVDDKI
QHRIESLEAYAIDACKNDDQKKTAGVILKAMGLPRTSSSAVNLLIDIGYFPVHVNLDLLK
FNVHTEYSDEILSAAESLLLDSSDPDEMERKDLTHLKVYAIDVDEADELDDALSATRLQD
GRIKVWIHVADPTSLVQPGSKIDREAMRKGTSIFLPTATFPMFPEKLAMEGMSLKQGKVC
NAVSVSVVLHHGGGIAEYTVENSIIRPTYMLTYESASELIHLNLEEEAELRILSEAAALR
LQWRRQQGAIDTATIDTRIKVANPDDLEPSINLYVENQADPAMRLVSEMMILCGEVIATF
GSCNNIPLPYRGQPQSNIDASAFSHLPEGPVRSSAYVKIMRAAEMDFRKPIRHGVLGIPG
YVQFTSPIRRYMDLLAHYQVKAFLRGDSLPYSAGQLEGMASLINMRVRVAKRLYNSSLRY
WLLEFLRRQPKEKKFRALILRFIKDRVAALFLTEVGIQASAWVSVGSQIGDEIEVWVEEA
HPRDDVLSLKEVA
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggctgtacgagcagcgaatagctgctccgtctttcgctctgtttcttcgcct
cctttctcctcgtttccatgtcgtctctcccatttcgctccctctcgatttcgcggagtc
tcaaaattaaggtttcaagcaccggcttctcggccagagaagcttcttccctattggggc
attctcagctgttctgtttacagtctcgttgagagcgtcatggaagagctcgaagtgttg
agggcgaggaagcgagtttatgccagcagcaaagtgggattagtaagcagcgggcagctt
gttgagggtaaagtcgataagcgggtactgcagaaagggttacttctggaattccggaag
gattctgaacgggtactactggcagttgcacagaaacccgatggcaaaaagaactgggtg
gtgtctgatcagaatggggtgacatcctcaattaaaccacaacaaattacattcattgtt
cctggtgtagaaaattttgaccacacggagatatcagatttcattgaaaaagctcataaa
aacttggacccaacattacttgaatatgcttggatggagctactggagaagaacaagtca
gtgacagcagaagaacttgctgagattatttttggtagcgtggagccggtggagagctat
tgtgcccatttattactatcaaaagatgaagtttacttcagtgtggtggaggctaaagga
tcccactctgtttatgggcctcgccctgctgtgcaggtagaagaacttctacgcaggaaa
catgcaaaagaggaagctgaaaaggaacttcaggagtttgtagggctactgatgtcagcc
aagggagtttctttacattccaagcctcccaaagaatcatggacagttgatgataaaatc
caacatagaattgaatctcttgaggcttatgcaattgatgcatgtaaaaatgatgatcaa
aagaaaacagctggagtgatcctcaaggcaatggggctgccaaggacatcgtcttctgca
gtaaatctcctcatagacattggttattttcctgtacatgtcaatcttgatctcttgaag
ttcaatgtccatactgaatattcagatgaaattctctcagctgccgaaagccttttgtta
gactcatctgatcctgatgagatggagagaaaagatcttacacatttgaaagtttatgca
attgatgttgacgaagctgatgagcttgatgatgccctcagtgcaacaaggctgcaggat
ggccggatcaaagtgtggatacatgttgctgatccaactagcttagttcaacctggaagc
aaaatagacagagaggcaatgagaaaagggacctctattttcttgcccactgccactttt
cctatgttcccggagaagcttgcaatggagggaatgagcttgaaacaaggaaaagtttgc
aatgctgtcagtgtatctgttgtactgcatcatggtggcggcattgcagagtacacagta
gaaaactcgattattagaccaacctatatgttgacatatgagagtgcatctgagttgatt
cacttgaacctggaagaggaggctgaacttcgaattctatctgaggctgcagctctccgg
ttacaatggcgtcgccaacagggtgcaattgatacagcaacaatagatacacgtatcaag
gtggctaatccagatgacctagaaccatcaatcaatctctatgttgaaaatcaggctgat
cctgcaatgcgacttgtctccgagatgatgatactgtgtggggaggttatagccaccttt
ggttcatgcaataacatccctcttccctacagaggccaaccccaatcaaacattgatgcc
tctgcattttcccatcttccagaaggacctgttagaagttcagcatatgtcaaaataatg
cgtgcagcagaaatggatttcaggaagcctatacgtcatggagtcttgggtattcctggt
tatgtgcagtttacatctccaatccgtcgatatatggatcttcttgctcattatcaggtg
aaagcatttcttagaggtgattctcttccatactcagctggtcagttggaagggatggca
tcactcataaacatgcgggtccgagtagcaaaaaggctctacaacagcagccttaggtat
tggttattggagtttctgagaaggcaacccaaggaaaagaagttccgtgctttgatcctt
agatttatcaaagatcgtgttgcagccttgttcttgacagaggttggaattcaagcttct
gcatgggtatctgtaggttcacagattggagatgaaattgaagtttgggtggaagaagct
catccacgtgatgatgtcctttctctaaaggaagttgcttaa

DBGET integrated database retrieval system