KEGG   Nelumbo nucifera (sacred lotus): 104598017Help
Entry
104598017         CDS       T04131                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00562  Inositol phosphate metabolism
nnu01100  Metabolic pathways
nnu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104598017
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104598017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nnu01009]
    104598017
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104598017
    3.1.3.48  protein-tyrosine-phosphatase
     104598017
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104598017
Protein phosphatases and associated proteins [BR:nnu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104598017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 104598017
NCBI-ProteinID: XP_010258182
UniProt: A0A1U7ZWQ2
LinkDB All DBs
Position
Un
AA seq 420 aa AA seqDB search
MGLKISTQGPGTIGNLVEFHHPYYLLNYLTRTLYIHHLVSKQRRRMLVGGYDLDMSYITD
RLLAMSFPAEHMRAMYRNPLWQVKSVLDMKHLGHYKVYNLCAEESYDPSHFHGCVEIFPF
DDHHVPSLPMIKLFCESVHSWLSLDPQNIAVIHCMAGKGRTGLMVCAYLIYCGMSAEEAL
QLYAQRRTTNNEGVSIASQLRYVEYWSKILTFPRGVGNGPPDVNLPQPCSRELRRIRLYD
TVNTDSVFFVISEVQEIPGQLYRPYVEVCRNGCRQIKKGYQRTNSQCYYLSFINNDEDSK
ETSDVPHVVVQMDTENPVIYQKTCLDYCFDKPLQVTGDVRVVFYQKMIGGRLFYACFNTA
FITNSVLQFSIRDLDKVGYKGKSVCGSAFCVELLFGPANARCSLSPPMNNDDDDVSKDFL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggggctgaaaatatcaacacaggggccaggcacaatagggaacctggtggagttccat
catccttattatttgcttaattatctcaccagaacgctctacatccatcacctggtctcc
aagcaacggaggcgaatgcttgttggaggatatgaccttgatatgtcatatatcacagac
cgcttgttggcaatgtcatttcctgcagaacacatgcgagcaatgtaccgaaatccactc
tggcaggtcaagtctgtgctagacatgaaacatctggggcactacaaggtttacaacttg
tgtgcagaggaaagttatgatccatcacatttccatggatgtgtggagattttcccattt
gatgaccaccatgtcccatccctcccaatgatcaagctcttctgtgaaagtgtgcattca
tggctttctcttgatccacaaaatattgcagttatacactgcatggcaggaaaaggtcgg
acaggcttaatggtatgtgcctacttaatctattgtggcatgtcggcagaggaagctctt
cagctgtatgcacaaagacgaactaccaacaatgaaggagtttcgatagcaagccaactc
cgttatgtggaatactggtccaaaatattaacttttccaaggggagttggtaatggacca
cctgatgtgaacttacctcaaccatgtagcagggaattgcgacgaatccgactttatgac
acggttaacactgactcggttttttttgtgatctcagaggtacaggagatccctggccaa
ctttaccgtccatatgtggaagtatgtaggaatggttgcagacaaatcaagaaaggatat
caaagaactaacagccaatgttattacctctccttcattaataatgatgaggattcaaag
gagacaagtgatgtacctcatgttgttgtacaaatggatacagaaaatccagttatctac
cagaagacgtgtctagactactgcttcgataaacctttacaggtcactggagatgtgagg
gtagttttttaccaaaaaatgattggagggcgtctcttctatgcctgcttcaatacagct
tttatcacaaatagcgtactacagttctccatacgggatttggacaaagttgggtacaag
ggtaaatctgtatgtggctctgccttctgtgttgaattgctgtttggccctgctaatgca
agatgttcattatcacctccaatgaataatgatgatgatgatgttagcaaagatttcttg
taa

DBGET integrated database retrieval system