KEGG   Nelumbo nucifera (sacred lotus): 104598340Help
Entry
104598340         CDS       T04131                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00052  Galactose metabolism
nnu00500  Starch and sucrose metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104598340
   00500 Starch and sucrose metabolism
    104598340
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104598340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104598340
NCBI-ProteinID: XP_010258663
UniProt: A0A1U8AAI7
LinkDB All DBs
Position
Un
AA seq 901 aa AA seqDB search
MGSSWKMSLIFTLFFLSFFSLSHGEGEEPIGFGYKIKWINVGPSGKSLTAQLQLIKNSSV
FGPDVQSLSFLASFETDTQLRVRITDSNHQRWEIPEEIIPRQTHLSQRRLPESRYNQLEN
HQLLSENYSLSIPESDLILTFSSSSPFGFRIIRGSTGDVLFDTSPDKSDSGTVLVFKDQY
IQVSSSLPADKSSIFGLGEHTKKTFRLTHNETLTMWNADIASANLDVNLYGSHPFYMDVR
SPLIDGKAQAGLTHGVLLLNSNGMDIVYTGSRITYKIIGGVLDFYFFAGPSPESVMEQYT
NLIGRPTPIPYWAFGFHQCRYGYKNVSDLEGVVAGYAKAGIPLEVMWTDIDHMDGYKDFT
LDPVNFPADKLSKFVDRLHQNGQKYVLILDPGISVNETYGTYIRGMKADVYIKRNGTPYL
GSVWPGPVYFPDFLSPAAAIFWGGEIAAFRKIISFDGLWLDMNEISNFITSPPSPSSTLD
DPPYRINDAGMRRPIISRTVPATALHFGNLTEYNVHNLYGLLESKATNEALIKVTGKRPF
ILTRSTFVGSGKYTAHWTGDNAASWDGLAYSIPAILNSGLFGIPMVGADICGFMQDTTEE
LCSRWIQLGAFYPFSRDHSDKQSIRQELYLWESVSIAAKKALGLRYRLLPYFYTLMYEAH
TRGTPIARPLFFSFPEDIKTYDISSQFLIGKGVMVSPVLKPGAVSVDAYFPAGEWFDLFD
YSQSVSAKYGKYVTLDAPPEHINVHVREGNILAMQEEATTTEAARKTGFELLVAVDSSGN
ATGEVFLDDGEEVEMGGVGGTWSFVRFASKVFKNEMRIRSEVQNGGYAVSQKWIIQKVSF
VGLKQVRRIKTYSLAMKGRNLNGNSGMMVSFNGKGRFGVTEIRGLSILIGEDFELKLQFS
Q
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcagctggaaaatgagtctcatcttcactttattctttctttctttcttctct
ctgtcacatggagaaggtgaagaaccaattggatttggctacaaaatcaaatggattaac
gtcggtccctccgggaaatcgctcaccgcccagctccagttgataaagaattcatctgtc
ttcgggccggatgttcagagtctcagctttctggcaagctttgagactgatacacagttg
agagtccgtataactgattccaaccaccagagatgggaaatcccagaagaaataattcca
cgccaaacccacctctctcaacgaagattgccagagagtcggtacaaccagttagaaaac
caccaactattatcagaaaactactccctctccattccagaatccgacctgattctcacc
tttagctcctcctctccatttggattccgcatcattcgtggctccactggtgatgtcctc
tttgacacctcaccggataagtcagattccggcactgtgcttgtgttcaaagatcaatac
atacaagtctcatcgtcactaccggcggacaaatcttccatctttggcttaggggagcac
accaagaagacattccggctaacccacaatgagacactgacaatgtggaatgccgacatt
gcaagtgcaaatctagatgtcaatctatatggttctcacccattctacatggacgtcaga
tcaccattaattgatggtaaagctcaagcaggattgactcacggtgttctgttacttaac
agtaacggtatggacattgtatacactggatcccgtataacatacaagataattggaggt
gttcttgatttctactttttcgccggaccgtcgccggaatccgtcatggagcaatacact
aatctcattggccggcctacacccattccttactgggcatttgggtttcaccagtgccgt
tacggctacaaaaatgtgtctgatcttgagggagtggttgcggggtatgcaaaagctggg
attcctctagaagttatgtggacagatatagaccatatggatggatacaaagatttcaca
cttgatcccgtcaactttcccgcagacaagttgagtaaatttgtggatcgacttcaccag
aatggacagaaatatgtactcatcttagatccaggcattagtgtgaatgagacatatggt
acatacattcgaggtatgaaagcagatgtctacataaagcgtaatggaactccttacctg
gggagtgtgtggccagggccagtttacttccctgatttcctaagcccagctgctgctatc
ttttggggtggtgaaattgcagccttcaggaagattatctcctttgatggcctctggctt
gacatgaatgaaatctccaacttcataacctcccctccttccccctcgtctacactggat
gaccccccttacagaattaacgatgctggaatgagacggcccatcattagcagaactgtc
cccgcaacagcccttcactttggtaatctgaccgaatacaatgtccataacctctatggg
ttgttagagtcgaaagctacaaatgaagccttgatcaaggtgactgggaaaagaccattt
atactgaccaggtcgacttttgttggatctggaaagtatacagcacactggactggtgac
aatgccgcctcttgggatggcctagcatactcaattccagcaattttgaactctggatta
tttgggattccaatggtgggagctgatatctgtggatttatgcaggatacaaccgaagag
ctctgcagtcgttggattcagctaggagccttttatcccttctctagagaccactcagac
aagcagtcgatccgacaagagctctatctatgggaatctgtttccattgcagcaaagaag
gcactggggcttcgttaccgcctacttccttacttctacacattaatgtatgaagcacac
acaaggggaacccccattgcacggccattgttcttttcattccctgaggacatcaagacc
tatgacatcagctcacagtttctgatcggtaaaggtgtaatggtttcaccagtgttgaag
ccaggagcggtttcagttgatgcatatttcccagcaggagagtggtttgacctgtttgat
tattcacaatcagtgagtgcaaaatatggaaaatacgtcacacttgatgccccaccagag
catataaatgtgcatgttagggaaggcaatattttggccatgcaagaagaagccacgaca
acagaagcagcccgtaaaactggttttgagctcttggtggcagttgacagcagtggaaat
gccacaggagaagttttcttggacgatggagaggaggtggagatgggaggggtgggagga
acatggagctttgtgagatttgcaagcaaggtcttcaagaatgagatgaggatcagatca
gaggttcagaatgggggatatgctgtcagtcagaagtggatcatacagaaggtaagtttt
gtagggttgaaacaagtgaggaggatcaagacatatagcttggccatgaaagggagaaac
ttgaatgggaactcagggatgatggtgagtttcaatgggaagggaaggtttggcgtaaca
gagatcagaggcctgtcaatactaataggagaggattttgaattgaaattgcagttcagc
cagtaa

DBGET integrated database retrieval system