KEGG   Nelumbo nucifera (sacred lotus): 104601757Help
Entry
104601757         CDS       T04131                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00010  Glycolysis / Gluconeogenesis
nnu00020  Citrate cycle (TCA cycle)
nnu00620  Pyruvate metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Module
nnu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104601757
   00020 Citrate cycle (TCA cycle)
    104601757
   00620 Pyruvate metabolism
    104601757
Enzymes [BR:nnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104601757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 104601757
NCBI-ProteinID: XP_010263519
UniProt: A0A1U8A859
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MASSIVFRVSPTYNTISFSSSISNGLPLPSRLSRFHIRPRRKIPTVHAKIREIFMPALSS
TMTEGKIVSWVKSEGDVLSKGDSVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAP
IGLLAETEEEVAEAKAKAASSKTGPSSPPPAAPSPPPPSPAPSASSPSPPPQSPSPPPVY
DGPRKIVATPYAKKLAKQHKIDIGLIVGTGPFGRITPSDVESAAGIGPSKSSISNVGSAN
ASPSPAPPVAATATAASASPAMPPPIPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYSV
TTDALDALYEKVKPKGVTMTALLAKAAAMALVQHPVVNATCKDGKSFTYNSNINIAVAVA
INGGLITPVLQDADKLDLYLLSQKWKELVQKARAKQLQPHEYNSGTFTLSNLGMFGVDRF
DAILPPGQGAIMAVGASKPTVVADADRFFSVNSKMLVNVTADHRIIYGADLAAFLQTFAK
IVENPESLTL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctatcgtttttagggtttctccaacctacaacaccatctcattctcatct
tctatttccaatggccttccattgccttcccgcctttccagattccacattaggccgcgc
cggaagatccctaccgtccacgccaagatcagagagatcttcatgcctgccctcagctcc
accatgacggaaggcaagatcgtatcttgggtcaaatccgaaggtgacgttctctccaaa
ggtgacagcgttgtcgtcgttgagtctgacaaggccgatatggatgtcgagacattctac
gatggaattcttgctgcaattgtagtcggagaaggcgagactgctcctgttggtgccccg
attggattgctcgctgaaacggaagaagaagtcgcagaagctaaagctaaggctgcttct
tctaagactggcccttcgagcccaccgcctgcagcaccttcacctcctccaccttctcct
gcaccttctgcttcctctccttcgcctcctcctcaatcgccgtcgcctccccctgtctat
gatgggccgaggaagattgtcgctactccatatgcaaagaagctcgccaagcagcataag
atcgatattggattgatcgttgggaccggaccgtttggtcggataacgccatctgatgtc
gagtctgctgcgggaattggaccttccaagagtagcattagcaatgtaggttctgcaaat
gcttctccttctcctgctcctccagttgctgctactgctaccgctgcttctgcttctcct
gcaatgcctcctccaattcctggctctactgttgtccccttcacaaccatgcaagcagct
gtctcaaagaacatggtggaaagcctctcggtacctactttccgcgttggatattctgtg
acaactgacgcccttgatgctttatacgagaaggtgaaaccgaagggagtaaccatgacc
gcattgttagcaaaagccgcagctatggcgcttgtgcaacatccagttgtgaatgcgacc
tgtaaagacgggaaaagttttacatataacagcaatataaatatagcagtggcggtggct
attaatggtggactgataactcctgttcttcaggatgcagataagttggatctttatctg
ctttctcaaaaatggaaagagctcgtacagaaagctcgagctaagcaacttcaaccccat
gagtacaattcaggcacgttcactctttccaatttgggcatgtttggagttgacagattt
gatgcaattcttcccccaggccaaggggctattatggcggttggagcatcaaagcccaca
gttgtggcagatgcagatagattcttcagtgtgaatagcaaaatgctggtgaatgttaca
gctgatcaccgaataatctatggtgctgacttggcagctttccttcagacatttgcaaag
attgttgagaatccagagagcctaacattgtag

DBGET integrated database retrieval system