KEGG   Nelumbo nucifera (sacred lotus): 104604553Help
Entry
104604553         CDS       T04131                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu03030  DNA replication
nnu03410  Base excision repair
nnu03420  Nucleotide excision repair
nnu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104604553
   03410 Base excision repair
    104604553
   03420 Nucleotide excision repair
    104604553
   03430 Mismatch repair
    104604553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nnu03032]
    104604553
   03400 DNA repair and recombination proteins [BR:nnu03400]
    104604553
Enzymes [BR:nnu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104604553
    6.5.1.6  DNA ligase (ATP or NAD+)
     104604553
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104604553
DNA replication proteins [BR:nnu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104604553
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104604553
DNA repair and recombination proteins [BR:nnu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104604553
   NER (nucleotide excision repair)
    Other NER factors
     104604553
   MMR (mismatch excision repair)
    Other MMR factors
     104604553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase HEV_ORF1
Motif
Other DBs
NCBI-GeneID: 104604553
NCBI-ProteinID: XP_010267243
UniProt: A0A1U8AHU9
LinkDB All DBs
Position
Un
AA seq 763 aa AA seqDB search
MSTVSSCWLAQARFLPLLYSSSPLSRVSFSISPSSLRFFSSKNPKRPMAEKRTIADVLMA
NARAAAARKKVTRPSPKKRKALEDNGTPTTESELKQTEEPKEPNLKKVAVAKKGEGPISV
EERIGKLKKKAADFDPKSAAFWKDGEPVPFLFVARAFDMIANETGRIVITELLCNVFRTI
IASTPGDLIPVIYLSANKIAPAHEGVELGIGDAALIKALAEAYGRKEEMIKKQLKELGDL
GLVAKESRSSQSVMFKPPPLTVAKVFDTFRVIAKESGKDSQDKKRKHIKGLLVAATDCEP
LYLVRLLQSKLRIGLAEQTLLVALGQAAVYSGKHSNPSSQIQSPLEEAAKIVKQVYSVLP
IYDKIVPALLSGGVWKLQETCNFTLGVPVGPMLAKPTKGVSEILDKFQDTEFTCEYKYDG
ERAQIHYMEDGSVEIYSRNAERNTGKFPDVVHSVKRVKKSSVKSFVLDCEVVAYDRDKQK
ILPFQILSTRARKGVSMSDIKIDVCIFAFDMLYVNGQPLLQEQLNIRREHLYNSFEEEPG
VFQFATTITSNDLEEIQKFLENAVNSSCEGLIVKTLSRDATYEPSKRSHNWLKLKKDYMD
SVGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDDSKEEFQSICKIGTGFSEATLEECSRR
LLPKVIPKPKPYYRHTDTVNPDVWFEPSEVWEVKAADLTISPVYCAATGVVDPNKGISLR
FPRLIRIREDKNPEQATSSDQVAEMYNAQKSNHSNNHDEDEDY
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagtgagctcatgttggttagctcaggctcgattccttcctcttctctactcg
tcttcacccctttcccgcgtatcgttttctattagcccttcttccctgagattcttctcc
tccaaaaaccctaaacgacccatggccgaaaagcgcaccattgccgatgtcctcatggcc
aacgctcgagcggccgccgctcggaagaaagtcacccgtccttcacccaagaaacgaaaa
gcgctagaagataatggaactccgacgacagagtcggagcttaaacaaactgaagaacct
aaagaacccaatttgaagaaggtggcagtggcgaaaaagggagaagggcccatcagtgtc
gaagaaaggattgggaaattgaagaagaaggcagcagattttgacccgaagtccgctgct
ttctggaaagatggggagccagtgccatttctgtttgttgctcgtgcttttgatatgatc
gccaatgaaacggggaggattgttattacggaacttctctgtaatgttttcaggactata
attgcttctacgcctggagatttaattcccgtcatttatctctcggctaataagattgcc
ccagctcatgagggtgtggaactgggaattggagatgctgctctcattaaggcgcttgct
gaggcttatggaaggaaagaagaaatgatcaagaaacaactcaaagaattgggagactta
ggccttgttgcaaaagaaagccgctcatctcaaagtgtgatgttcaagcctcctccttta
actgttgccaaagtttttgatacatttcgtgtaattgccaaggaatctggaaaagatagt
caagacaagaaaaggaaacatatcaaagggctacttgttgcagctactgattgtgaacct
ttatatttggttcgtctattgcagtcaaagttgagaattggtttggcagaacagactctc
ctggtagctctaggacaagctgctgtatattctggaaaacattcaaacccatcttcacaa
attcagtctccgcttgaagaggctgcaaaaattgtcaaacaagtttactctgtacttcct
atctatgataaaattgttcctgctcttcttagtggcggtgtgtggaagctccaagagaca
tgcaactttactttaggtgtaccggttggacctatgttggcaaaaccaaccaaaggtgta
tctgaaattttggataaatttcaggacacagaattcacctgtgaatacaagtatgatgga
gaacgtgctcagatacattatatggaagatggttcagttgaaatatatagtcgaaatgct
gaacgaaatactggaaaatttcctgatgttgtgcactctgttaaaagagtgaagaagtcc
tctgttaaatcatttgttcttgactgtgaagtggttgcttatgatcgtgataaacagaag
attctgccattccagatcctcagtactcgtgctcgtaaaggtgtgtccatgagtgacata
aaaattgatgtttgcatatttgcctttgatatgctgtacgttaatgggcaaccacttctc
caggagcaactgaacattcgtagagagcatctttataattcatttgaggaagaaccagga
gtatttcaatttgcaacaacaattacttcgaatgaccttgaggaaatacaaaagtttctt
gaaaatgctgttaattccagttgtgaaggactgattgtcaaaactctaagtagagatgcc
acatatgagccttcaaaacggtcgcataattggctgaaattgaagaaagattatatggac
agtgttggcgactcattagatttagtaccaattgcagcatttcatggtcgtggaaaacgt
acaggtgtttatggtgccttcctccttgcttgttatgatgactcaaaagaagaatttcaa
agtatttgcaaaataggcactggattttctgaggcaacacttgaagagtgttctcgcaga
cttcttccaaaagtgatcccaaaaccaaagccatattatcggcatacagatacagttaat
ccagatgtatggtttgaaccatctgaggtttgggaggtgaaagcggcagatttgactatt
agtcctgtttattgtgctgcaactggtgtggtagatcctaacaagggcatctctctccgt
tttccacgtctgattcgaatccgagaagacaagaacccagaacaggccacatcctctgat
caggtagctgagatgtataatgctcaaaagagcaaccactctaataatcacgatgaagat
gaagattattga

DBGET integrated database retrieval system