KEGG   Nelumbo nucifera (sacred lotus): 104606710Help
Entry
104606710         CDS       T04131                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104606710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nnu03036]
    104606710
Enzymes [BR:nnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104606710
Chromosome and associated proteins [BR:nnu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104606710
   Polycomb group proteins
    PRC2-EZH2 complex
     104606710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 104606710
NCBI-ProteinID: XP_010270355
UniProt: A0A1U8AV13
LinkDB All DBs
Position
Un
AA seq 928 aa AA seqDB search
MSSKDTPCASASRLDPSKDSQIVEASQSRKDIVSIIDSLKKQVAAERCVFIKKRMEENKE
KLMGITNHVYALSKERRCNGINGTNKNLGLLVKRQGDTLGMLNGLDLNNGEKDTNGAQED
NHASSAVLIGTSFGVKNNIVRPIKLPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
DQNGGEALICSDSEEEIVEEEEDKREFGNCEDYILRKAIQEVGSSDDVLDLLAQCFSRRP
CEVKARYELLTKEEKDALFIKKGNIEDNTQMDDSFFDKDLDAALDSFDNLFCRRCLVFDC
RLHGCSQDLVFPADKQLPWNHPDEEKVPCGMHCYRLAQKSESIATMSSPVHDGLEEKPVP
SSCSAGNQISPRKKGANPSAGRKTKSNQSESASSNARNASESSESEIRPRQDSASIHHSS
SPPKAKLVGKCGVRKRNSKRVAERVVVCMRKRQKKMVTSDSDSVVSGCIWPRDMKLRSNS
RKENEEAISSQRKVKTPPIRKSRRKESPIQESKKSALAEVHDEPSDEMAKGPLVATSDET
SRKEEFVDDNVCKHEATGDKSWKAIEKGLFAKGLEIFGRNSCLISRNLLNGMRTCAEVFQ
YMNCTENKLSYRVGDGANSLVEGHSKVDYNDTMGSELRTRSRFVRRRGRVRRLKYTWKSA
GYHSIRKRITERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCH
CAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQ
RVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQ
FVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERINAGEELFYDYRYEPDR
APAWAKKPEATGSKKEEVSSSGRAKKLA
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaaggacacgccttgcgcttccgctagcagattagacccttcaaaggactct
cagatagtggaagcaagtcaaagtcgaaaggatatcgtatcaattattgattctttgaag
aaacaagttgctgctgagagatgcgtttttataaagaaaagaatggaagaaaacaaggaa
aagctgatgggtattaccaatcatgtttatgcattgtcaaaagaaagaagatgcaatggg
ataaatggtaccaacaaaaatctaggcctactggtgaagagacaaggagatacacttggt
atgctgaatggtcttgatctaaataatggtgaaaaggatacaaatggcgctcaggaagat
aaccatgcctcatcagcagttcttataggaactagttttggagtgaagaataacatagtt
cgccctatcaagctcccagaggtgaagaaattgcctccctatactacatggatatttttg
gatagaaaccagcgaatgactgaggatcaatcagtggttgggcgaagaagaatttattat
gaccagaatggtggagaagctctaatttgcagtgacagcgaggaggaaatagttgaggag
gaagaagacaagagagaatttgggaattgtgaagattatatccttcgaaaggctatccaa
gaggtcggttcatctgatgatgtgctcgatctactagcacaatgtttttcaagaagacct
tgtgaggttaaggcaagatacgaacttctaacgaaggaagagaaagatgcactgttcatt
aagaagggtaatattgaagataatacacaaatggatgattcttttttcgataaagatctg
gatgcagctctggattcttttgataatctattttgtcggcgatgtctagtatttgattgt
agattacatggatgttcacaggatcttgtctttcctgctgataagcaactcccatggaac
catccagatgaggaaaaagtaccatgtggcatgcattgctatcggctggcacaaaaatct
gaaagtattgctacgatgagctctccggtgcatgatggtcttgaagaaaaaccagttcct
tcatcttgtagtgctgggaatcagatatctcctagaaagaaaggtgctaatccatcagct
ggcagaaaaacaaaatctaatcagagtgaaagtgcttcatctaatgcaagaaatgcatca
gagagcagtgaatcagagataagacctaggcaggattctgcttccatccaccattcttca
tcacctccaaaggctaagcttgttggaaaatgtggagttcgtaagagaaacagtaaacga
gttgctgagcgtgttgttgtttgcatgcggaagagacagaagaaaatggtcacttctgat
tctgattctgttgtgagtggatgcatttggcccagagatatgaagcttagatctaattca
cgcaaggaaaatgaggaggctatttcttcacaacggaaagtaaaaactccacccattaga
aagtctaggaggaaggaatcaccaattcaggaaagtaagaaatctgcattggctgaagtt
catgatgaaccatctgatgagatggcaaaaggcccactggtggctactagtgatgaaacc
tcaagaaaagaagagtttgttgatgacaatgtctgcaaacatgaagcaactggtgataaa
tcttggaaagctatcgagaagggcctttttgcgaaaggcttagagatttttggaaggaat
agctgtctaatttcaaggaatcttttgaatggaatgaggacatgtgcagaggtcttccag
tacatgaattgcacagaaaacaagctatcatacagggtaggtgatggtgcaaattctctg
gttgaaggccattccaaagttgattataatgatactatgggtagtgaactgagaacaagg
tcaaggtttgtgcgcaggaggggtagagttcgccggttgaagtatacttggaagtctgct
ggttaccattcaattaggaaacggattactgagaggaaggaccagccatgccgacaatat
aacccttgtggttgccaatcagcatgtgggaagcagtgtgcttgccttttaaatggaacc
tgttgtgagaaatactgtgggtgtcctaagagttgcaagaatcggtttagaggctgccat
tgtgccaaaagccaatgccgaagtcgacaatgcccatgctttgctgcagatagagaatgt
gatccagatgtttgtagaaattgctgggttggttgcggtgatggtactcttggagtccct
tcccagagaggtgataattatgaatgtaggaatatgaagcttcttctcaagcaacaacaa
agggtcttacttggaaggtctgatgtatctggctggggagcgtttcttaagaatagtgtt
ggcaaacatgaatacctgggagagtacaccggagaacttatctcacaccgagaagctgat
aagcgtggaaagatatatgatcgtgaaaattcatcatttcttttcaatctgaatgatcag
tttgttcttgatgcttatcggaagggtgataaattgaaatttgctaatcattctcctgat
ccaaattgctatgccaaggtcatcatggtagcaggggatcacagggtgggtatatttgca
aaggaacggataaatgctggggaggaactcttttatgattatcgctacgagccagaccga
gctcctgcttgggccaaaaagcctgaagctacagggtccaaaaaggaggaagtttcttca
agtggtcgtgcaaagaagctcgcttag

DBGET integrated database retrieval system