KEGG   Nelumbo nucifera (sacred lotus): 104611028Help
Entry
104611028         CDS       T04131                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00250  Alanine, aspartate and glutamate metabolism
nnu00410  beta-Alanine metabolism
nnu00430  Taurine and hypotaurine metabolism
nnu00650  Butanoate metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Module
nnu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104611028
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104611028
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104611028
   00430 Taurine and hypotaurine metabolism
    104611028
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104611028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104611028
NCBI-ProteinID: XP_010276236
UniProt: A0A1U8B5R3
LinkDB All DBs
Position
Un
AA seq 495 aa AA seqDB search
MVVSSTATDSSENVQSTFASRYVRTSLPRFKMPEQSIPKEAAYQIISDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPIGEEEIAIG
VGTIGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGFYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKFLNDLLTKKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNVMENCMENAKVLREGIEK
MGRFDVVSKDVGVPLVAFALKDCSKHTVFEISESLRRFGWIVPAYTMPPDAQHIAVLRVV
IREDFGRSLAVRLIADIEKVLKELDSLPSRVQPRVETKDGNGGGHANKKSEREMQEEITT
YWRNLVTGKKTNGVC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtggtatcatcgacggctacagactccagcgagaatgtgcagtcgacattcgcgtcc
agatatgtgcgcacatcgcttcccaggttcaagatgccggagcagtcgatcccaaaggaa
gcggcgtatcagatcatcagcgacgagctgatgctggacgggaacccgaggctgaacctg
gcctcctttgtgaccacatggatggagccggagtgcgataagctcatcatggacgccatc
aacaagaactacgtcgacatggacgagtatcccgtcaccactgagcttcagaatcgatgt
gtaaatatgatagcccacctcttccatgccccaataggagaggaagaaatagccattgga
gtgggaacaatagggtcctcagaggcaataatgctggcaggactagccttcaagaggaag
tggcagaacaagaggaaagctgagggaaaaccctacgataagccaaacattgttactggt
gccaatgtgcaggtttgctgggagaaatttgcaaggtactttgaggtggaactgaaagag
gtgaagctaagggaaggcttctatgtgatggacccagtgaaagcagtagagatggttgat
gagaataccatatgtgtggcagcaatattgggctcgacacttacaggggagtttgaagat
gtcaaatttttgaatgatctccttactaagaagaataaggaaactggttgggatactccg
atccatgttgatgctgctagtggtggattcatagctccattcttatacccggaacttgag
tgggatttcagactgccactggttaagagtatcaatgtcagtgggcacaagtatggcctt
gtctatgctggtgtgggatgggttgtttggaggactaaagatgatttgccagaagagctt
atcttccacataaattatcttggggctgatcaacccacttttactctcaacttctcgaaa
ggctccagtcaaataattgctcaatattatcagttaatccgtttggggtttgagggttac
aagaacgttatggaaaattgcatggagaatgcgaaggtgttgagggaagggatagaaaag
atgggtcggtttgatgtggtctccaaggatgtgggtgtaccactagttgcctttgctctt
aaagattgcagcaagcacacggtctttgaaatatcagaaagtttgagaaggtttggatgg
atcgtcccagcatacacaatgcctcctgatgcacaacacattgctgtcctccgagtggtg
attagagaggatttcggtagaagccttgcggtgcggctaattgctgatatagagaaggtt
ttgaaggagttagactctttgccaagcagggtgcagcctcgagttgaaacaaaagatggc
aatggaggtggacatgcaaataaaaagagtgagagagagatgcaagaggagataacgact
tattggaggaatctggtgactggcaaaaagaccaacggagtttgctaa

DBGET integrated database retrieval system