KEGG   Nelumbo nucifera (sacred lotus): 104611594Help
Entry
104611594         CDS       T04131                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00620  Pyruvate metabolism
nnu00710  Carbon fixation in photosynthetic organisms
nnu01100  Metabolic pathways
nnu01200  Carbon metabolism
Module
nnu_M00168  CAM (Crassulacean acid metabolism), dark
nnu_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
nnu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
nnu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104611594
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104611594
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     104611594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 104611594
NCBI-ProteinID: XP_010277028
UniProt: A0A1U8BJ10
LinkDB All DBs
Position
Un
AA seq 964 aa AA seqDB search
MARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEVY
ELSAEYERNHDPQKLDELGKVLTSLDAGDSIVLTKAFSHMLNLANLAEEVQIAYRRRTRQ
KKGDFHDESNATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRNCLAQLNAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGIPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYYSQIEDLMFELSMWRCSDELRARADQLHRSSKKDAKHYIEFWKQVPP
NEPYRVILSDVRDKLYSTRERSRHLLASGMSDIPEEATYTNIEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLGIGSYREWSEDHRQ
EWLLSELSGKRPLFGPDLPKTEEIADVLDTLHVIAELPPDNFGAYIISMATAPSDVLAVE
LLQRECRVKKPLRVVPLFEKLGDLEAAPAAVARLFSIDWYRNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKTQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEIAILATKE
YRSIVFQESRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHAIGKDIRNINMLQEMYNKWPFFRVTLDLVEMVFAKGDPGIAALYDKL
LVSEDLWPFGERLRANYEETKKLLLKVAGHKDLLEGDPYLKQRLRLRDSYITTLNVCQAY
TLKRIREPSYDVKVRPHLSKEITESSKPANELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaacttagagaagctggcgtcgatcgacgctcagcttaggctcttggttcct
gggaaggtctccgaagatgacaaactggttgagtacgatgcgctgcttctggatcgcttc
ctcgacatccttcaggatttacatggggaagatctaaaggaaacggttcaagaggtttat
gagctttctgctgagtatgaacggaaccatgatcctcagaagctggatgagcttggaaaa
gttttgacaagtctggatgcaggggattccattgttcttacgaaagcattctcacacatg
cttaacttagccaatctggctgaggaggttcagatcgcttacagacggagaaccaggcag
aaaaagggtgattttcatgatgagagcaatgcaacaactgaatcagacattgaggagact
ctgaagagacttgttgtgcagctaaagaagtctccagaagaagtcttcgatgccctgaag
aatcagacagtggatttggtcctcactgcacatcctactcaatcagttcgtagatccttg
ctccagaagcatgcaaggataaggaactgcttagcgcagttgaatgccaaagacattact
cctgatgataaacaggagcttgatgaggctctacagagagagattcaagctgcatttcgt
acggatgagatacggaggactcctccaactccacaagatgaaatgagggcaggaatgagc
tacttccatgagacaatctggaagggtatcccaaaattcctacggcgtgtagacactgct
ttgaagaacattgggataaatgagcgtgttccttacaatgcccctctcattcagttctct
tcttggatgggtggggaccgtgatggaaatccaagggtaactcctgaagttacaagggat
gtatgcttattggcaagaatgatggctgctaacttgtactattcacagatagaggatctt
atgtttgagttgtccatgtggcgttgcagtgacgagcttcgtgcccgtgcagatcaactc
cataggtcctcaaagaaagatgcaaaacattatatagaattctggaaacaggttcctcca
aatgagccctatcgtgttattctcagtgatgtgagggataaattgtatagtacacgtgaa
cgttctcgtcatttattagccagtggaatgtctgacattcctgaggaggcaacttatacc
aatattgaacagttcttggaacctcttgagctctgttatagatcactctgtgcttgtggt
gatcgaccaattgccgatggaagccttcttgatttcttacggcaagtctctacatttgga
ttgtcacttgtgaggcttgatatcagacaagaatcagataggcacactgatgtcatagat
gccattacaaaacatttgggcattggatcctaccgggaatggtctgaggaccaccgtcag
gaatggctgttgtctgaactgagtgggaagcgtccattgtttggtcctgatcttccaaaa
actgaagaaattgctgatgtgttggacaccttgcatgtcatagcagaactgcctccagac
aactttggggcatacatcatctcaatggcaactgcaccatcagatgtgcttgcagttgag
ctcctacagcgtgaatgccgtgttaagaagccactgagagttgtaccattgtttgaaaag
cttggtgatcttgaggctgctcctgctgctgtggctagactcttctcaatagactggtat
agaaacaggatcaatgggaaacaggaagttatgatcgggtactcggattctgggaaggat
gctgggcgtctctctgcagcttggcagttgtataagactcaagaggaactagtaaaggtt
gcaaaacaatatggagtgaagctaacaatgttccatgggcgaggtgggactgttggaagg
ggaggtggtcctacacaccttgctatattatctcagccaccagacacaattcatgggtct
ctccgcgtgacagttcagggtgaagtaattgaacagtcttttggagaggagcacttgtgt
tttagaacactccagcgtttcacagctgctacactggagcatgggatgcaccccccagtc
tcaccaaagccagaatggcgtgcgctcatggatgagattgccatccttgctacaaaggaa
taccgttcgattgtcttccaggagtcccgatttgtagaatacttccgccgtgctactccg
gagctagagtacggtcgtatgaacattggtagccgtccatccaagcgaaaaccaagtggg
gggattgaatcactccgtgcaatcccatggatatttgcatggacccaaacaaggtttcat
ctcccagtgtggcttggatttggtgcagcattcaagcatgccattgggaaggacatccgg
aatatcaatatgctgcaggagatgtacaataaatggcctttctttagggtcacccttgat
ttggttgagatggtgttcgctaagggagaccctggcatcgctgctttgtatgacaagctt
ctagtctcagaagatctatggccttttggagaacgtttgagggccaattatgaagaaacc
aagaaacttctcctgaaggttgctggtcacaaggatcttcttgaaggtgatccatacctg
aaacagagactccgtctccgtgattcatacatcacaaccctgaatgtatgccaggcctat
acgctgaagcgtatccgtgagccaagctacgatgtgaaggtgaggccacacctgtcaaag
gagatcacagaatcaagcaagccagctaatgagctagtgaagttaaacccaactagtgaa
tatgctcctggcctggaggataccctaatcttgaccatgaagggtattgcagcaggcatg
cagaacactggttga

DBGET integrated database retrieval system