KEGG   Nelumbo nucifera (sacred lotus): 104611833Help
Entry
104611833         CDS       T04131                                 

Definition
(RefSeq) glutathione S-transferase 2-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00350  Tyrosine metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104611833
Enzymes [BR:nnu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104611833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C DUF5060
Motif
Other DBs
NCBI-GeneID: 104611833
NCBI-ProteinID: XP_010277366
UniProt: A0A1U8B8F3
LinkDB All DBs
Position
Un
AA seq 231 aa AA seqDB search
MDSRPHQDTSGSFFSSSSDKLQLYSYWQSSCSWRVRFALNLKRLPYEYKAVNLSKGEQFS
PEFERLNPLHFVPVLVDGDLVVSDSFAILLYLEEKYPQNALLPVDAKCRAVNLQAASIVT
SSMQPLHMLSVLKYIEEKVGPEERQSWAEYHIGKGFAALEKLLKDFAGRYATGDEICMAD
VFLAPQISVAVMRFKFDMSKFPTLCRIYEANKVLPAFQASLPERQPDASID
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggactcgagacctcatcaggatacctctggcagttttttttcctcgtcctcggataaa
cttcagctgtattcctactggcagagctcgtgctcgtggcgtgttcgcttcgccttaaac
ctgaaaagacttccctatgagtacaaagcagtcaacctttcaaaaggagagcagtttagt
ccagagtttgagcgtttaaaccctcttcactttgttccggtgttagtggatggtgatctt
gtggtttcagactcctttgcaatcttactgtatttggaagagaagtatcctcaaaacgcc
cttttgccagttgatgccaaatgcagagcagtcaacctccaggctgcaagtattgttacc
tctagcatgcaacctcttcatatgttgtcagtgctgaagtacattgaggaaaaagttggt
cctgaagaacgccaatcatgggctgagtatcatatagggaaaggttttgctgctcttgag
aagttgttgaaagattttgctggcagatacgctactggggatgaaatatgcatggctgat
gtctttttggccccacagatcagtgtagctgttatgaggttcaagtttgatatgtccaag
ttcccaactctatgtaggatctatgaagcaaataaggttctcccagcattccaagcttct
ttgccagaaagacaacctgatgctagtatagattga

DBGET integrated database retrieval system