KEGG   Nonomuraea sp. ATCC 55076: BKM31_00105Help
Entry
BKM31_00105       CDS       T04759                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00380  Tryptophan metabolism
noa00630  Glyoxylate and dicarboxylate metabolism
noa01110  Biosynthesis of secondary metabolites
noa01130  Biosynthesis of antibiotics
noa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BKM31_00105
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BKM31_00105
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BKM31_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AQZ60130
UniProt: A0A1U9ZQB4
LinkDB All DBs
Position
complement(20546..22549)
Genome map
AA seq 667 aa AA seqDB search
MQSERDAKDRQLDEHRVPLDDHTMTTDQGIPVDDTDNSLKAGTRGPTLMEDFHFREKITR
FDHERIPERVVHARGSGAYGIFELYEPLGEYTCAEFLNDTSARTPTFVRFSTVAGFRGSA
DTVRDVRGFATKFYTGQGNFDIVGNNIPVFFIQDGIKFPDFVHAVKPEPHWEIPQAQSAH
DTFWDFVQLQPESLHMVMWVMSDRAIPRSYRMMQGFGVHTFRLVNAQGQGTFVKWHWRPR
LGTYSLVWDEVLRIQGNDPDFNRRDLWEAIERGAYPEYELCVQLVPESREHDFDFDLLDP
TKIIPEEQVPLRPIGKMTLTRNPQNFHAETEQVAFHTANVVPGIDFTNDPLLQARNFSYL
DTQLLRLGGPNFTQIPINRPIAPVRNDQRDGFHQHLIHESRTSYAPNSISGGCPAARDGY
RHYQEKVEGTKIRRRSPSFEDHYSQATLFWNSMADWEKRHIVAAFLFELGHVERPPIKQA
VVAHLGRIHPDLGAAVAQGLGLPAPGGGQVHSRTSPALSMTGQPRSVATRKIAILMADGT
DAAAVTTLRQALEGQGAVCEIVAPREGTLGGLPVDRQLSAASSVLYDAVVAADGALLSAS
ARAVFFVLEAFRHGKAVGAVGSGRQLVEAARLPNDVGVIVGDDIATAFAEAVAGHRFYDR
DVSGVPA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgagcgtgacgcgaaggaccgccagctcgacgagcaccgcgtacctctcgac
gaccacaccatgaccaccgaccagggcatcccggtcgacgacacggacaactcgctcaag
gccggcacccgcgggccgaccctcatggaggacttccacttccgcgagaagatcacccgc
ttcgaccacgagcgcatccccgagcgggtggtgcacgcccgcggctccggcgcgtacggg
atcttcgagctgtacgagccgctcggcgagtacacctgcgccgagttcctgaacgacacc
tccgcgcggacgcccaccttcgtgcgcttctccaccgtcgccggcttccgcggctccgcc
gacaccgtacgcgacgtgcgcggcttcgccacgaagttctacaccggccagggcaacttc
gacatcgtcggcaacaacatccccgtcttcttcatccaggacggcatcaagttccccgac
ttcgtgcacgccgtcaaacccgagccgcactgggagatcccgcaggcgcagtcggcgcac
gacacgttctgggacttcgtccagctccagcccgagtcgctgcacatggtcatgtgggtg
atgtccgaccgggcgatcccgcgcagctaccggatgatgcaggggttcggggtgcacacg
ttccggctggtcaacgcccaggggcaggggacgttcgtcaagtggcactggcggcccagg
ctcgggacgtactcgctggtgtgggacgaggtgctgcgcatccagggcaacgaccccgac
ttcaaccgccgcgacctctgggaggcgatcgagcggggcgcctaccccgagtacgagctg
tgcgtgcagctcgtgcccgagtcgcgcgagcacgacttcgacttcgacctgctcgacccc
acgaagatcatccccgaggagcaggtcccgctgcggcccatcggcaagatgacgctcacc
cgcaacccgcagaacttccacgccgagaccgagcaggtcgccttccacacggccaacgtc
gtgcccggcatcgacttcaccaacgaccccctgctccaggccaggaacttctcctacctc
gacacccagctcctgcgcctcggcggccccaacttcacgcagatccccatcaaccggccg
atcgcccccgtacgcaacgaccagcgcgacggcttccaccagcacctgatccacgagtcg
cgcaccagctacgcccccaactccatcagcggcggctgccccgccgcccgggacggctac
cggcactaccaggagaaggtggaaggcaccaagatccgccggcgcagccccagcttcgag
gaccattacagccaggccaccctgttctggaacagcatggccgactgggagaagcggcac
atcgtggccgcgttcctgttcgagctggggcacgtcgagcggccgcccatcaagcaggcc
gtggtcgcccacctcggcagaatccatcccgacctcggggcggccgtcgcgcagggcctc
ggcctgcccgcgcccggcggcggccaggtgcactcccgcacctcccccgccctcagcatg
accggccagccccgcagcgtcgccacccgcaagatcgccatcctgatggccgacggcacg
gacgccgccgccgtcaccaccctgcgccaggccctggagggccagggggccgtctgcgag
atcgtcgcgccccgcgagggcacgctcggcggcctcccggtggaccggcagctcagcgcg
gccagctccgtcctctacgacgcggtggtggccgccgacggcgccctcctgtccgcctcc
gcccgggccgtgttcttcgtcctggaggccttccgccacggcaaggcggtgggggccgtg
gggtcgggccggcagctcgtggaggcggcccggctgcccaacgacgtgggggtgatcgtc
ggggacgacatcgccaccgccttcgccgaggccgtggccgggcaccgcttctacgaccgg
gacgtttccggcgtgcccgcctga

DBGET integrated database retrieval system