KEGG   Nonomuraea sp. ATCC 55076: BKM31_01050Help
Entry
BKM31_01050       CDS       T04759                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00071  Fatty acid degradation
noa00280  Valine, leucine and isoleucine degradation
noa00281  Geraniol degradation
noa00362  Benzoate degradation
noa00592  alpha-Linolenic acid metabolism
noa01100  Metabolic pathways
noa01110  Biosynthesis of secondary metabolites
noa01120  Microbial metabolism in diverse environments
noa01130  Biosynthesis of antibiotics
noa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKM31_01050
   00592 alpha-Linolenic acid metabolism
    BKM31_01050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKM31_01050
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BKM31_01050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKM31_01050
   00642 Ethylbenzene degradation
    BKM31_01050
Enzymes [BR:noa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BKM31_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQZ60288
UniProt: A0A1U9ZQT0
LinkDB All DBs
Position
complement(236486..237649)
Genome map
AA seq 387 aa AA seqDB search
MFVDGVRTPFGRSGPKGLYAETRADDLVVRVIRELIRRNPNLPPERVDEVAIAATTQIGD
QGLTIGRSAAVLAGLPKSVPGYAIDRMCAGAMTAVTTVAGGIAFGAYDVAIAGGVEHMGR
HPMGEGVDPNPRFLSEKLVDPSALVMGMTAENLHDRYPSITKERADAYAVLSQEKAAKAY
ADGKIQPDLVPTAIRTAEKGWGLAVEDEAPRPGTTMEGLSGLKTPFRPHGHVTAGNSSGI
NDGATGCVVAAKEVAEELGLAPKMRLVSYAFAGVDPEVMGVGPIPSTERALRLAGLDISD
IGLFEINEAFAVQVLAFLEHFGIADDDPRVNAYGGAIAYGHPLASSGVRLMTQLARQFGE
RPDVRYGITTMCVGMGMGGTVIWENLT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgtcgacggcgtacgcacgcctttcggcaggtcagggccgaaaggactgtacgcg
gagacccgcgcggacgacctggtcgtccgcgtcatccgcgagctcatccggcgtaacccc
aacctgccgccggagcgcgtggacgaggtcgccatcgccgcgaccacgcagatcggcgac
cagggcctgaccatcggccgctcggccgccgtgctggccgggctgcccaagagcgtgccc
ggctacgccatcgaccgcatgtgcgcgggcgcgatgacggcggtcaccacggtcgcgggc
ggcatcgcgttcggcgcgtacgacgtcgccatcgccggcggcgtcgagcacatgggccgc
cacccgatgggcgagggcgtcgaccccaacccgcgtttcctgtcggagaagctggtcgac
ccgagcgcgctggtcatgggcatgacggccgagaacctgcacgaccgctacccgtcgatc
accaaggagcgcgccgacgcgtacgcggtgctctcacaggagaaggccgccaaggcgtac
gcggacggcaagatccagccggacctggtgccgaccgcgatcaggaccgcggagaagggc
tggggcctggccgtcgaggacgaggcgcccaggccgggcaccacgatggagggcctgagc
gggctcaagacgccgttccgcccgcacggccacgtcacggcgggcaactcctccggcatc
aacgacggcgccaccggctgcgtcgtggccgccaaggaggtcgccgaggagctggggctg
gcgccgaagatgcgcctggtctcctacgccttcgcgggcgtggaccccgaggtcatgggt
gtcgggccgatcccgtccaccgagcgggcgctgcgcctggcgggcctcgacatctccgac
atcgggctgttcgagatcaacgaggcgttcgccgtccaggtgctggcgttcctggagcac
ttcggcatcgccgacgacgacccccgcgtcaacgcctacggcggcgcgatcgcctacggg
cacccgctcgcctcctcgggcgtgcggctgatgacgcagctcgcccggcagttcggcgag
cgtcccgacgtgcgttacggcatcaccacgatgtgcgtcggcatgggcatgggcggcacc
gtgatctgggagaacctgacgtga

DBGET integrated database retrieval system