KEGG   Nonomuraea sp. ATCC 55076: BKM31_01270Help
Entry
BKM31_01270       CDS       T04759                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AQZ70029
UniProt: A0A1V0AIN5
LinkDB All DBs
Position
complement(282283..283350)
Genome map
AA seq 355 aa AA seqDB search
MLAKPVKAMPKQDGTLLYEPKWDGFRCIIFRDGDEVYLGSRNERPFTRYFPELVEAVKAE
LPDKVVIDGEIVLPVGSQLDFDALQQRIHPAKSRVTMLSERTPAQFIAFDLLALGDESLM
ETPFSERRARLEALFGEKAGSIRLTPVTTSYEQAGEWFETFEGAGLDGIIVKPGDQPYMP
DKRTMFKVKHERTADVVICGYREHKTGPIVGSLLLGLYGDDGRLHHVGVAASFPMKRRAE
LVEEIKPYLAELSEHPWGHWAEQAQANLGQPAAGPATGGQRVPGAVSRWNAKKDLSFIPL
RPELVIEVAYDQMEGDRFRHTAHFRRWRPDRTPESCTYEQLERPVSYNLDDILAR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaaaccggtcaaggccatgccgaagcaggacggcacgctgctctacgagccg
aagtgggacgggttccgctgcatcatcttccgcgacggcgacgaggtctacctgggcagc
cgcaacgagcggccgttcacccgctacttccccgagctggtcgaggcggtcaaggccgag
ctgcccgacaaggtggtgatcgacggcgagatcgtgctgccggtgggctcgcagctcgac
ttcgacgcgttgcagcagcgcatccatccggccaagtcgcgggtgacgatgctctcggag
cgcacgccggcccagttcatcgccttcgacctgctggcgctgggcgacgagtcgctgatg
gagacgccgttctcggagcggcgggcgcggctcgaggcactgttcggcgagaaggccggg
tccatccggctgacccccgtcacgaccagctacgagcaggccggtgagtggttcgagacg
ttcgagggggccgggctcgacggcatcatcgtcaagccgggcgaccagccgtacatgccg
gacaaacgcacgatgttcaaggtcaagcacgagcgcaccgccgacgtcgtgatctgcggc
taccgcgagcacaagacggggccgatcgtggggtcgctgctgctcggcctgtacggcgac
gacgggcggctgcaccacgtgggggtggcggcctcgttcccgatgaagcgcagggccgag
ctggtcgaggagatcaagccgtacctcgcggagctgagcgagcacccgtgggggcactgg
gcggagcaggcgcaggccaacctcggccagccggccgccgggcccgcgacgggcgggcag
cgggtgccgggggcggtgtcgcggtggaatgccaagaaggacctgtcgttcatcccgctg
cggccggagctggtgatcgaggtggcctacgaccagatggaaggcgaccggttccggcac
acggcgcacttccggcggtggcggcccgaccgcacgcccgaatcgtgcacttatgagcag
ttggagcgtccggttagttacaaccttgacgacatccttgcccgctag

DBGET integrated database retrieval system