KEGG   Nonomuraea sp. ATCC 55076: BKM31_05940Help
Entry
BKM31_05940       CDS       T04759                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BKM31_05940
Enzymes [BR:noa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BKM31_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF4350 Glyco_hydro_14 Glyco_hydro_2_C Glyco_hydro_35 YacG Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AQZ61088
UniProt: A0A1U9ZT16
LinkDB All DBs
Position
1324809..1326794
Genome map
AA seq 661 aa AA seqDB search
MYPERPAGIAYGGDYNPEQWPREVLEEDVALMREAGVNLVTLGLFSWALMEPEEGRFAFG
WLDEIIDRLHANGVAVDLGTPTAAPPAWFVARHPDVLPVTREGVRIGFGGRQSACSSAPA
FREATARLVRALGEHYRGHPAVVMWHVHNEYGAPLGECYCEHSVAAWRAWLRQKYRDISA
LNDAWGTTFWGQTYTDWAEIDAPRANHTTVNPAQRLDYARFSDGQHREHYALQRDILREL
TPGLPVTTNFAGTVNCKSTDLWQWARELDVIANDHYLQAERPDNHIDLAMSADLARSVAG
GRPWMLMEHSAGAVNWQPRNLAKRPGEMRRNSLAHVARGSDSVLFFQFRASRFGAEKFHS
GMVPHAGTGSEQWREIVRLGADLRKLAGLRGSRVRAEVALVWDWESYWALELDWRPSVDL
TFRERMDAFYEALWREHVTVDFVHPSADISGYRVVVAPSSYLLTEASAKNLHRYVEAGGH
LLVSYFSGIVDEHDTIHPGAHPGALRELLGLSIEEFHPLREHETVTLTTGDPARVWSERV
RPAGAVTVEGFADGPDAGHPALTRHDLGAGSAWYLATAPVTGLRDLLARVLDHAGVSRPR
GLPDTLELVRRGGHVFLINHGDRPVTAEGVSGVSVFDGVRHDGPVTVPAGAVTVLLETPR
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtatccggagcgtcctgccgggatcgcctatggcggcgactacaacccggagcagtgg
ccgcgcgaggtcctggaggaggacgtcgccctcatgcgggaggccggggtcaacctggtc
acgctgggcctgttctcgtgggcgctgatggagcccgaggaggggcggttcgcgttcggc
tggctcgatgagatcatcgaccggctgcacgcgaacggcgtcgccgtcgacctcggcacg
cccaccgccgccccgcccgcctggttcgtcgcccggcaccccgacgtgctgccggtgacc
agggagggcgtgcgcatcgggttcggcggccggcagagcgcctgctccagcgccccggcc
ttccgcgaggcgaccgcgcggctggtgcgggcgctgggcgagcactaccgcggccacccg
gccgtggtcatgtggcacgtgcacaacgagtacggggcgccgctcggcgagtgctactgc
gagcacagcgtggcggcctggcgcgcgtggctccgccagaaatatcgcgatatttccgca
ttgaacgacgcctggggcaccacgttctggggccagacctacaccgactgggccgagatc
gacgccccgcgcgccaaccacacgaccgtcaaccccgcccagcgcctcgactacgcccgc
ttcagcgacggccagcaccgcgagcactacgcgctgcagcgcgacatcctgcgcgagctg
acccccggcctccccgtgaccacgaacttcgccggcaccgtgaactgcaagtccaccgac
ctgtggcagtgggcccgcgagctggacgtgatcgccaacgaccactacctccaggccgag
cggcccgacaaccacatcgacctggccatgtccgccgacctcgcgcggtcggtggcgggc
ggccggccgtggatgctcatggagcactcggcgggcgcggtcaactggcagccgcgcaac
ctcgccaagcggcccggcgagatgcgccgcaacagcctcgcgcacgtcgcccgcggctcc
gacagcgtgctgttcttccagttcagggcctcgcggttcggggccgagaagttccactcc
gggatggtgccgcacgcgggcaccggctccgagcagtggcgcgagatcgtgcggctcggc
gccgacctgcgcaagctcgccgggctgcggggaagccgggtgcgggccgaggtggcgctc
gtgtgggactgggagtcgtactgggcgctggagctggactggcggccgtcggtggacctg
acgttcagggagcggatggacgccttctacgaggcgttgtggcgcgagcacgtcacggtg
gacttcgtccacccttccgctgatatttcggggtatcgggtggtggtggcgcccagctcg
tacctgctgaccgaggcgtccgccaagaacctgcaccgatacgtggaagcgggcggccac
ctgctcgtgtcgtacttctccggcatcgtggacgagcacgacaccatccacccgggcgcc
cacccgggcgcgctgcgcgagctgctcggcctgtcgatcgaggagttccacccgctgcgc
gagcacgagacggtcaccctcaccaccggcgatccggcccgcgtctggtccgaacgcgtc
cgcccggcgggcgcggtcaccgtcgagggcttcgccgacggccccgacgccggccacccc
gccctcacccgccacgacctcggcgcgggcagcgcctggtacctggccaccgcccccgtc
accggcctgcgcgacctgctcgcgcgggtgctcgaccacgccggcgtgtcccgcccgcgc
ggcctgcccgacaccctcgaactggtgcgcaggggcggccacgtcttcctgatcaaccat
ggcgaccggcccgtgacggccgagggggtgagcggcgtgagcgtgttcgacggcgtgcgg
cacgacgggccggtcaccgtcccggccggagcggtgaccgtcctgctggaaaccccccga
ccctag

DBGET integrated database retrieval system