KEGG   Nonomuraea sp. ATCC 55076: BKM31_27980Help
Entry
BKM31_27980       CDS       T04759                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:noa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BKM31_27980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:noa03400]
    BKM31_27980
Enzymes [BR:noa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BKM31_27980
DNA repair and recombination proteins [BR:noa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BKM31_27980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AQZ64785
UniProt: A0A1V0A3I7
LinkDB All DBs
Position
6262075..6263079
Genome map
AA seq 334 aa AA seqDB search
MVRLPAYAPMLAQLGTLTSVQGDDWAVEMKWDGVRALAYIEDGAVRLMSRNGKDITPAYP
ELQLMAGAIGRHDAVLDGEVVAFDDAGRPSFEALQPRMHQRNPAAVAELTRAVPVTYMAF
DILHLDDSGVVARPYTERRELLEGTLRPGYRWQVPVWFADHASQAFDSSRQLGLEGVVCK
RMGSPYRPGRRSGEWTKIKNVSAVEIVIGGWKPGGGRRSGMIGSLLLGAYDARGRLRYVG
HVGTGFTQAMLRDLHDRLAPLERDDSPFDEVVPREHARDAHWVEPRMVGEVQYAEVTGDG
RLRHPSWRGLRPDRDPREASTADLLPGQGDAAAG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggctgccggcctacgcgccgatgctggcccagctcgggacgctgacctccgtc
cagggcgacgactgggccgtggagatgaagtgggacggcgtgcgcgccctcgcctacatc
gaggacggcgccgtccgcctgatgtcgcgcaacggcaaggacatcacccccgcctacccc
gagctgcagctcatggccggcgctatcggccggcacgacgccgtcctcgacggtgaggtg
gtggccttcgacgacgcggggcggcccagcttcgaggcgctgcagccccgcatgcaccag
cgcaacccggccgccgtggccgagctgaccagggcggtgccggtcacgtacatggccttc
gacatcctgcacctcgacgactccggggtggtcgcgcgaccctacaccgagcggcgcgag
ctgctggagggcacgctgcggcccgggtaccggtggcaggtgcccgtgtggttcgccgac
cacgcgtcccaggcgttcgactcctcgcggcagctcgggctcgaaggggtcgtgtgcaag
cggatgggctcgccctaccgtcccggccggcgcagcggcgaatggaccaagatcaagaac
gtcagcgcggtcgagatcgtcatcggcggctggaaaccgggcggcgggcggcgctcgggg
atgatcggatcgctgctgctcggcgcctacgacgcgcgcggccggctgcggtacgtcggc
cacgtcggcaccggcttcacccaggccatgctgcgcgacctgcacgaccggctcgcgccc
ctggagcgggacgactcgccgttcgacgaagtggtgccgcgcgagcacgcccgcgacgcc
cactgggtggagccgcggatggtcggcgaggtccagtacgccgaggtcaccggcgacggg
cggctgcggcacccgtcgtggcgggggctgcggcccgaccgcgatccgcgcgaggcgagc
accgccgacctccttcccgggcagggggatgccgccgcgggctga

DBGET integrated database retrieval system