KEGG   Nonomuraea sp. ATCC 55076: BKM31_30165Help
Entry
BKM31_30165       CDS       T04759                                 

Definition
(GenBank) MFS transporter
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_4 LacY_symp DUF2079 OATP
Motif
Other DBs
NCBI-ProteinID: AQZ65141
UniProt: A0A1V0A4L6
LinkDB All DBs
Position
complement(6749545..6750789)
Genome map
AA seq 414 aa AA seqDB search
MTDTSTAAPDARAADRYELRLLVILFLSFGFVFFDRQALSFLAPYMDRDFGLSNAELGTL
SGVLALTWALAGMFAGRLSDALGRRKPILVVAVVLFSLFSASSGLMGGFAGLLVARALMG
TAEGAVLPMAQSLMVEASRESRRGFNMGLLQGSSAGLLGGIVAPLVVVWLAETYDWRVAF
YVTIVPGLIMAALIWKFVRERAPRAPQVREETVKVPLGEVLRLRNIVVCMLIACCYLTWF
VTIITFTPTYLTQVKGFDPGTMSGVMTCLGVAWVLWGFATPAISDRIGRKPALIGFTALA
VCCPLAVVFVESPVLLGALMVVTYTGLGCFTLFMATIPAETVPRAALATALGVIMGVGEL
AGGFLGPMVAGWASDQWGLRAAMFIAAAGALAVVGFCFLLKETAPAVLRRRAAA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccagcacggccgcgccggacgcccgcgccgccgaccggtacgagctccgc
ctgctcgtcatcctcttcctgtccttcgggttcgtcttcttcgaccgtcaggcgctgtcg
ttcctcgcgccgtacatggaccgggacttcggcctgtccaacgccgagctgggcacgctg
tccggcgtgctggcgctcacgtgggcgctggccggcatgttcgccggccgcctgtcggac
gcgctcgggcggcgcaagccgatcctggtcgtggccgtggtgctgttctcgctgttctcc
gcctcgtccgggctcatgggcgggttcgccgggctgctcgtggcgcgggcgctgatgggc
acggccgagggcgcggtgctgccgatggcgcagtcgctgatggtggaggcgtccagggag
agccggcgcggcttcaacatggggctgctgcagggctcgtcggcggggctgctcggcggc
atcgtggccccgctggtcgtggtgtggctggccgagacctacgactggcgggtcgcgttc
tacgtcacgatcgtccccgggctgatcatggccgcgctcatctggaagttcgtgcgcgag
cgcgctccccgcgccccccaggtgcgggaggagacggtcaaggtgccgctgggcgaggtg
ctgcggctgcgcaacatcgtggtctgcatgctcatcgcctgctgctacctgacctggttc
gtcaccatcatcacgttcacgccgacgtacctgacccaggtgaagggcttcgaccccggc
acgatgagcggcgtcatgacctgcctgggggtggcgtgggtgctgtgggggttcgccacg
cccgccatctccgaccggatcgggcgcaagccggcgctgatcgggttcacggcgctggcg
gtgtgctgcccgctggccgtcgtgttcgtcgagagccccgtgctgctcggcgccctcatg
gtcgtcacctacaccggcctcggctgcttcacgctgttcatggccacgatcccggccgag
accgtgccccgcgcggcgctggccacggccctcggcgtgatcatgggcgtgggcgagctg
gccggcgggttcctcgggccgatggtggcgggctgggcgtccgaccagtgggggttgcgg
gccgcgatgttcatcgccgccgccggcgcgctggccgtcgtggggttctgcttcttgctg
aaggagacggcgcccgctgtcctgcgccgccgggccgccgcatga

DBGET integrated database retrieval system