KEGG   Nonomuraea sp. ATCC 55076: BKM31_31795Help
Entry
BKM31_31795       CDS       T04759                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00500  Starch and sucrose metabolism
noa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKM31_31795
Enzymes [BR:noa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BKM31_31795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glucodextran_C Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AQZ65434
UniProt: A0A1V0A5E9
LinkDB All DBs
Position
complement(7119356..7122616)
Genome map
AA seq 1086 aa AA seqDB search
MNAIRRSALALIVVVALITVPRDPVLARTPAPGGPGVPSHFGLARKDCVGTAAGRASKVW
YTVAGGVLSDVYEPTIDNTNVETLQFAVTDGRTFTELQARDTTYEVSTDHSGMTCTITSA
SRAGRYRLTTTYLTDPDRNAVVVRARLQPPTLRLYARLDASVNGNGGGGTPNGGPDSGVV
DATTGAPVVWDDNTRTSAPARDYAVPTHLALRAERRLPQASVGYAGTPSDGAVQLDAARE
LTPYTEAPAGNVVATARLPIDARGEVTFALGFGRDRAAALRTADAAAARPFEVTRARYEA
GWAAYDATLRRPPAALADFYRLSANVLKASEDKTFPGAVVASLASPWGQAIGAGELVGGE
AVYFGSYREVFARDLYEAFTGFLAAGDLATARATARFLLERQQLPDGRLPRNSLLNGKLA
PDSGGDQLDETAYPILMAYQSGLSGVWEDVRAAADFLVSHGPAFGVERWEEQSGYSPSTI
AAEIAALVAAGELATGNGDQARARVYRATADHFARSIKAWTVTTTGPYAPRSFLRLSRTG
DPDAAVSYNLGNGGPTEDQRRVVDAGFLELTRLGILPPDDPDVLASLPVVDRVIRRDTAS
GPGWYRYGSDTPGTEDGYGDCHEPDPTACAPSGKPWPTGNNGSGHVWPVLAGERAEQALQ
TGDQAGAARLLTAMRAMASGTGLIPEQAWENVALPASPYGTDPATASIGFRDGGPAGSAS
PLTWAQAQVVRLVLSLGSTRPVEQPDVVRRRYADPPQAAPLTVTAPADGTAVPGTSVAVT
GTTVPGARVEVAATPIDTGAPTRVVSVRAGADGAFTASAPVAFGEVVLAVTATTSDGRRT
GYARRTVVGDIVGATTVLDADDPEGDDDGPGTYAYPTAADFHDGAFDLRRFQVITDDSTV
YLRAALRDLTPTFGNQMGAQLLDVYVRDPAATTTSTEAAFPQRNHRIAEQDGWSQRVEAQ
GFAAPVWVAADGTAKAGAVVRASGSTRTITIALPRAVFGTPGPGWRFAVVLAGQDGFSPD
QARSFAATPQPYQFGVCAEGGTAPLCAVDPGTVPKALDVLVPPGRSQADVLNPLLGPVTV
PAVQVP
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatccgccgatccgcgctggccctgatcgtcgtcgtcgcgctcatcaccgtc
ccccgagacccggtgctcgcccggacccccgcgccgggcgggcccggcgtcccgtcgcac
ttcggcctggcccgcaaggactgcgtcggcaccgcggcggggcgcgcctccaaggtctgg
tacacggtggcgggcggcgtcctgtccgacgtgtacgagcccacgatcgacaacacgaac
gtcgagaccctgcagttcgccgtcaccgacggccggacgttcaccgagctgcaggcccga
gacaccacctacgaggtgagcaccgaccactcgggcatgacgtgcacgatcacctccgcg
agcagggcgggccgctaccgcctgaccaccacctacctgaccgaccccgacaggaacgcg
gtggtcgtgcgggcccgcctccagccgcccaccctgcgcctgtacgccaggctggacgcg
agcgtgaacggcaacggcggcggcggaacgcccaacggcggccccgacagcggcgtggtg
gacgccacgaccggcgcccccgtcgtctgggacgacaacacgcggacctcggccccggcc
cgcgactacgccgtccccacccacctggcgctgcgcgcggagcggcgcctgccgcaggcg
agtgtgggctacgccggcacgcccagtgacggcgccgtccagctcgacgccgcccgcgag
ctgaccccttacaccgaggcgcccgccggcaacgtggtggccaccgcccggctgccgatc
gacgccaggggagaggtcacgttcgcgctgggcttcggccgcgaccgggccgccgcgctg
cggaccgccgacgccgccgccgcgcgcccgttcgaggtcacccgggcccggtacgaggcc
ggctgggccgcctatgacgcgaccctgcgcaggccgcccgccgcgctggccgacttctac
cggctctccgccaacgtgctcaaggccagcgaggacaagacgttccccggcgcggtcgtc
gcgtccctggccagcccgtgggggcaggcgatcggcgcgggcgagctggtcggcggcgag
gccgtctacttcggctcctaccgcgaggtgttcgcccgcgacctgtacgaggcgttcacc
ggcttcctggccgccggggacctggcgacggcccgcgccacggcccgcttcctgctggaa
cgccagcaactgcccgacggccgcctgccccgcaactcgctgctcaacgggaaactggcc
cccgactcgggcggcgaccagctcgacgagaccgcgtacccgatcctgatggcctaccag
tccgggctgagcggcgtgtgggaggacgtgcgggcggcggccgacttcctcgtctcgcac
ggcccggcgttcggcgtggagcggtgggaggagcagtcggggtactcgccgtccacgatc
gcggccgagatcgccgcgctcgtcgcggcgggcgagctggcgaccgggaacggcgaccag
gcccgggcccgcgtctaccgcgccacggccgaccacttcgcccgctcgatcaaggcgtgg
acggtcaccacgaccggcccgtacgccccccgctccttcctgcgcctgtcccgcaccggc
gacccggacgccgccgtcagctacaacctgggcaacggcggccccaccgaggaccagcgc
cgggtggtggacgcgggcttcctggagctgaccaggctcggcatcctgccgcccgacgac
ccggacgtgctggccagcctgcccgtcgtggaccgggtgatcaggcgcgacacggcgagc
ggccccggctggtaccgctacggctccgacacccccggcaccgaggacggctacggcgac
tgccacgagcccgaccccaccgcctgcgcgccgtccggcaagccgtggcccaccggcaac
aacggaagcggtcacgtgtggccggtgctggccggcgagcgcgccgagcaggcgcttcag
accggcgaccaggccggcgccgcccggctgctgaccgccatgcgggcgatggcgtccggc
accgggctcatccccgagcaagcgtgggagaacgtcgccctgcccgcctccccgtacggc
accgacccggccaccgcctcgatcggcttccgcgacggcggcccggccggctcggcgtcc
ccgctgacgtgggcgcaggcccaggtggtccggctcgtcctctccctcggctccacccgg
ccggtcgagcagcccgacgtggtgcgccgccgctacgccgacccgccccaggccgccccg
ctcaccgtcaccgcccccgccgacggcaccgccgtgcccggcacgtcggtggccgtcacg
ggcacgaccgtccccggcgcccgcgtcgaggtggccgccacgcccatcgacaccggcgcg
cccacccgggtcgtctcggtacgggcgggcgcggacggcgccttcaccgcctcggccccg
gtcgcgttcggcgaggtcgtgctcgccgtgacggccaccacctccgacgggcggcgcacc
gggtacgcccggcgaacggtcgtcggtgacatcgtgggcgccactacggtgctcgacgcc
gatgaccccgagggcgacgacgacgggcccggcacgtacgcgtacccgaccgccgccgac
ttccacgacggcgccttcgacctgcgcaggttccaggtcatcaccgacgacagcaccgtc
tacctgcgggccgcgctgcgcgacctcactcccacgttcggcaaccagatgggcgcgcag
ctcctcgacgtgtacgtccgggacccggcggccaccaccacctcgacggaggccgcgttc
ccgcagcgcaaccaccgcatcgccgagcaggacgggtggagccagcgggtggaggcgcag
ggcttcgccgcccccgtctgggtggcggcggacgggacggcgaaggccggggccgtggtc
cgggcgtcaggcagcacgcggacgatcacgatcgcgctgcccagggccgtcttcggcacg
ccgggcccggggtggcgcttcgccgtggtgctcgccggtcaggacgggttcagccccgac
caggccaggtcgttcgccgcgacgccgcagccgtaccagttcggggtgtgcgccgagggc
ggcacggccccgctgtgcgcggtggacccgggcaccgtgcccaaggcgctcgacgtgctc
gtgcccccggggcggtcgcaggcggacgtgctgaacccgctcctcggccccgtcaccgtc
ccggcggtgcaggtgccctga

DBGET integrated database retrieval system