KEGG   Nonomuraea sp. ATCC 55076: BKM31_39780Help
Entry
BKM31_39780       CDS       T04759                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00020  Citrate cycle (TCA cycle)
noa00480  Glutathione metabolism
noa01100  Metabolic pathways
noa01110  Biosynthesis of secondary metabolites
noa01120  Microbial metabolism in diverse environments
noa01130  Biosynthesis of antibiotics
noa01200  Carbon metabolism
noa01210  2-Oxocarboxylic acid metabolism
noa01230  Biosynthesis of amino acids
Module
noa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM31_39780
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM31_39780
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BKM31_39780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AQZ66772
UniProt: A0A1V0A9F1
LinkDB All DBs
Position
complement(8914492..8915709)
Genome map
AA seq 405 aa AA seqDB search
MPKIKVEGPVVELDGDEMTRIIWQFIKDQLILPYLDVDLKYYDLGIEHRDATDDQVTIDA
ANAIKKYGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVIFREPIIMSNVPRL
VPGWTKPIVVGRHAFGDQYRATDLKIPGEGTLTLTYTPKDGSEPIELDVYDFPGSGVAMA
MYNLDESIRDFARASMRYGLARNYPVYLSTKNTILKAYDGRFKDIFAEVYESEFKDEFEK
AGLTYEHRLIDDMVAAALKWEGGYVWAAKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGQ
TVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLAHRGKLDNTPEVTDFANKLEQ
VCIETVEGGQMTKDLALLVGGDAEWLTTQDFLAALDENLKKKMSA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcaaggtggagggccccgtcgtcgagcttgacggcgacgagatgacccgg
atcatctggcagttcatcaaggaccagctgatccttccctacctcgacgtcgacctgaag
tactacgacctcggcatcgagcaccgagacgccacggacgaccaggtcaccatcgacgcc
gcgaacgccatcaagaagtacggcgtcggtgtgaagtgcgccaccatcaccccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggaagtcccccaacgggaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatcatgtcgaacgtgccgcggctc
gtgcccggctggaccaagccgatcgtcgtcggccgtcacgccttcggcgaccagtaccgc
gcgaccgacctgaagatccccggcgagggcacgctcaccctgacgtacacgccgaaggac
ggctccgagccgatcgagctcgacgtgtacgacttccccggctcgggcgtcgcgatggcg
atgtacaacctcgacgagtcgatccgcgacttcgcccgcgcgtcgatgcgttacggcctg
gcccgcaactacccggtctacctctcgacgaagaacaccatcctcaaggcgtacgacggc
cgcttcaaggacatcttcgccgaggtctacgagagcgagttcaaggacgagttcgagaag
gccggcctgacctacgagcaccgcctcatcgacgacatggtcgccgcggcgctgaagtgg
gagggcggctacgtctgggccgcgaagaactacgacggcgacgtccagtccgacaccgtc
gcccagggcttcggctcgctcggcctgatgacctcggtcctgatgacccccgacggccag
accgtcgaggccgaggccgcgcacggcaccgtgacccgccactaccgccagcaccagcag
ggcaagcccacctccaccaacccgatcgcctcgatcttcgcgtggacgcgtggcctggcc
caccgcggcaagctcgacaacacccccgaggtgaccgacttcgcgaacaagctggagcag
gtctgcatcgagaccgtcgagggcggtcagatgaccaaggacctcgcgctgctcgtcggc
ggcgacgccgagtggctcaccactcaggacttcctggcggctctcgacgagaacctcaag
aagaagatgtcggcctaa

DBGET integrated database retrieval system