KEGG   Nonomuraea sp. ATCC 55076: BKM31_49315Help
Entry
BKM31_49315       CDS       T04759                                 

Definition
(GenBank) trehalose synthase
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AQZ68412
UniProt: A0A1V0AE83
LinkDB All DBs
Position
10914531..10916192
Genome map
AA seq 553 aa AA seqDB search
MRMTYTSDVWWKNAVVYCLDVETFKDGNGDGVGDFRGLTQQIDYLAGLGVTCLWLMPFFP
TPNKDDGYDITDFYSIDPRLGTLGDFVEFMRTAHDRGLRVIADLVVNHTSDQHPWFKEAR
SSRDSPRRDWYVWSDKPEPDNPEQIVFPDKESSVWEYDEGSGQYYLHSFYRHQPDLNVGN
PEVRDEITRILGFWMELGLSGFRVDAVPFLIENVNPRLANPHEFLADLRAFMTRRKGGSI
LLGEVNVPYKDLIAYFGDGLGDQITMCFDFIGMQKAWLSLARNDATPLADALRERPKPPK
DCQWAMFLRNHDELTLDKLTEEEREEVFRAFGPKKEMQIFGRGLRRRLPTMLGGDLRRIK
MAYSLMFSLPGTPVIFYGEEIGMGENLEEEGRMAVRIPMQWSEDGGFSQAPPVRDIPEGS
FAPDRVNVADQKRDTGSLLRWFQLLIERYRECPELAWGEYTVLETGHPAVLAHRCDADGA
TVVVAHNLCDTAQDVELRLDGLERFQLTDLLVDGTLEVSDQGVVRLPMDPHGCRWLRASR
PEIPPEDASVKSL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgacgtacacctccgacgtctggtggaagaacgccgtcgtgtactgcctggac
gtggagacgttcaaggacggcaacggcgacggcgtgggcgacttccgcgggctgacgcag
cagatcgactacctcgcggggctcggcgtgacgtgcttgtggctcatgccgttcttcccg
actcccaacaaggacgacggttacgacatcaccgacttctactccatcgacccccgcttg
gggacgctgggcgacttcgtggagttcatgcggaccgcccacgaccgggggctgcgggtg
atcgccgacctcgtcgtcaaccacacctccgaccagcacccgtggttcaaggaggcccgg
tcgagccgcgactcgccccgccgcgactggtacgtctggtcggacaagcccgagccggac
aaccccgagcagatcgtcttccccgacaaggagagcagcgtctgggagtacgacgagggc
tccggccagtactacctgcacagcttctaccggcaccagccggacctgaacgtgggcaac
cccgaggtcagggacgagatcacccgcatactcgggttctggatggagctcgggctgtcg
gggttccgggtggacgcggtgccgttcctcatcgagaacgtcaacccgcgcttggccaac
ccgcacgagttcctggcggacctgcgggcgttcatgacgcggcgcaagggcggctcgatc
ctgctcggcgaggtgaacgtgccgtacaaggacttaatcgcctacttcggtgacgggctg
ggcgaccagatcaccatgtgcttcgacttcatcggcatgcagaaagcgtggctgtcgctg
gcccgcaacgacgccaccccgctggccgacgccctgcgcgagcgcccgaagccgcccaag
gactgccagtgggcgatgttcctgcgcaaccacgacgagctgaccctcgacaagctgacc
gaggaggagcgggaggaggtcttccgcgcgttcgggccgaagaaggagatgcagatcttc
gggcgcgggctgcgccgccgcctgccgacgatgctcggcggcgacctgcggcggatcaag
atggcctacagcctgatgttctcgctgcccggcacgcccgtgatcttctacggcgaggag
atcgggatgggcgagaacctggaggaggagggccgcatggcggtccgcatccccatgcag
tggtccgaggacggcggcttcagccaggccccgccggtccgggacatccccgagggctcc
ttcgcgcccgaccgggtgaacgtggccgaccagaagcgggacaccggctcgctgctgcgc
tggttccagctcctcatcgagcgctaccgggagtgccccgagctggcgtggggcgagtac
accgtgctggagaccgggcatccggccgtgctcgcgcaccgctgcgacgccgacggcgcc
acagtggtggtcgcgcacaacctgtgcgacacggcccaggacgtggagctgcggctggac
gggctggagcgcttccagctcacggacctactggtggacgggacgctggaggtctcggac
cagggcgtggtgcggctgccgatggacccgcacggctgccgctggctgcgcgcctcccgc
ccggagatccccccggaggacgcctccgtcaagtcgttgtag

DBGET integrated database retrieval system