KEGG   Nonomuraea sp. ATCC 55076: BKM31_52545Help
Entry
BKM31_52545       CDS       T04759                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
noa  Nonomuraea sp. ATCC 55076
Brite
KEGG Orthology (KO) [BR:noa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM31_52545
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKM31_52545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: AQZ68958
UniProt: A0A1V0AFH4
LinkDB All DBs
Position
complement(11631638..11632039)
Genome map
AA seq 133 aa AA seqDB search
MLARLLRPKHVASAHCDLPCGVYDPAQARIEAESVKAIMEKYAANEDPVFRARAIKIKEE
RAELVKHHLWVLWTDYFKPPHLEQYPQLHQLFWDATKLAGAAGAKGTVDVAKAEDLLGKI
DEISKIFWETKAA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcacgactgctacgacccaagcatgtcgcttccgcacactgcgacctgccttgt
ggggtctatgaccccgctcaggcccggatcgaggccgagtcggtcaaggcgatcatggag
aagtacgcggccaacgaggacccggtcttccgcgcccgcgccatcaagatcaaggaggag
cgggccgagctggtcaagcaccacctctgggtgctctggaccgactacttcaagccgccg
cacctggagcagtacccccagctccaccagctcttctgggacgccacaaagctcgccggc
gccgcgggcgccaagggcacggtcgacgtcgccaaggccgaggacctgctgggcaagatc
gacgaaatctccaagatcttctgggagaccaaggccgcctaa

DBGET integrated database retrieval system