KEGG   Nonomuraea sp. ATCC 55076: BKM31_53910Help
Entry
BKM31_53910       CDS       T04759                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Inhibitor_I48
Motif
Other DBs
NCBI-ProteinID: AQZ69189
UniProt: A0A1V0AG84
LinkDB All DBs
Position
complement(11940322..11941755)
Genome map
AA seq 477 aa AA seqDB search
MRQHDTLFIGGEWVAPAGTGTIDVISPHTEEIVGRVPDGTTEDMERAVAAAREAFDHGPW
PRMTFAERAEVIARLAAIYNERQSEMAQLITEEMGSPITFSNLAQAPQPLGMLQFYAELG
RTFEQEEQRPGLFGPITVRREPVGVVAAVVPWNVPQFVTMTKVAPALLAGCTIVLKPAPE
TPLDAYLLAEWAAEAGVPAGVLNIVVAGREVGEHLVAHKGVDKVAFTGSTAAGRRIAAVC
GEQLKRVSLELGGKSAAIILDDADLAASMGFLSMASLMNNGQACVAQTRILASRNRYDEV
VDAIAAMVGAQPVGDPADPATGIGPLVAKRQQERVEGYIKLGMDEGAKIVVGGLDRPYDR
GWYVAPTVFAGVSNDMRIAREEIFGPVLAVIPYEDEADAVRIANDSDYGLAGTVWTADAE
HGMEVARQVRTGTYGVNCFMLETNAPFGGYKASGIGRELGPEGLNSYLEYKTIARLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagcacgacacgctgttcatcgggggcgaatgggtggcccccgcgggcaccggc
acgatcgacgtcatctccccccataccgaggagatcgtcggccgggtgccggacggcacc
accgaggacatggagcgcgccgtcgcggccgcccgggaggcgttcgaccacgggccctgg
ccccgcatgacgttcgccgagcgggccgaggtgatcgcccggctggccgccatctacaac
gagcgccagagcgagatggcccagctcatcaccgaggagatgggctcgccgatcacgttc
tccaacctcgcgcaggcgccgcagccgcttggcatgctccagttctacgccgagctcggc
cggacgttcgagcaggaggagcagcggcccggcctgttcggccccatcaccgtgcgcagg
gagcccgtgggcgtggtggcggccgtcgtgccgtggaacgtcccccagttcgtgaccatg
accaaggtcgcgcccgcgctgctcgcgggctgcacgatcgtgctcaagccggcccccgag
acgccgctggacgcgtacctgctggccgagtgggcggccgaggccggcgtgccggcgggc
gtgctcaacatcgtcgtcgccggccgcgaggtcggcgagcacctggtcgcccacaagggc
gtggacaaggtcgccttcaccggctccaccgccgccgggcggcgcatcgccgccgtctgc
ggcgagcagctcaagcgggtcagcctggagctcggcggcaagtccgccgcgatcatcctg
gacgacgccgacctggccgccagcatgggcttcctgtcgatggcctccctcatgaacaac
ggccaggcgtgcgtggcccagacccgcatcctggcctcccgcaaccgctacgacgaggtc
gtggacgccatcgccgccatggtcggcgcccagcccgtcggcgaccccgccgatcccgcc
accggcatcggccccctggtcgccaagcggcagcaggagcgcgtcgagggctacatcaag
ctcggcatggacgaaggcgccaagatcgtggtgggcggcctcgaccggccgtacgaccgc
ggctggtacgtcgcgcccaccgtcttcgccggcgtcagcaacgacatgcgcatcgcccgc
gaggagatcttcgggccggtcctcgcggtgatcccgtacgaggacgaggccgatgccgtc
cgcatcgccaacgacagcgactacggcctggccggcaccgtctggaccgccgacgccgag
cacggcatggaggtggcccgccaggtccgcaccggcacgtacggcgtgaactgcttcatg
ctggagaccaacgcccccttcggcggctacaaggccagcggcatcggccgcgagctcggc
cccgagggcctcaactcctacctggagtacaagacgatcgcccgcctgggctga

DBGET integrated database retrieval system